Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_017146767 783 bp mRNA linear INV 09-DEC-2024 homolog QIL1 (LOC108060860), mRNA. ACCESSION XM_017146767 VERSION XM_017146767.3 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Dec 9, 2024 this sequence version replaced XM_017146767.2. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..783 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..783 /gene="LOC108060860" /note="MICOS complex subunit MIC13 homolog QIL1; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 3 Proteins" /db_xref="GeneID:108060860" CDS 116..625 /gene="LOC108060860" /codon_start=1 /product="MICOS complex subunit MIC13 homolog QIL1" /protein_id="XP_017002256.2" /db_xref="GeneID:108060860" /translation="MTTMITTLMARTAAVTMTVYMTNRMGVWGKTEETDRLLQQITTG LQPLVGLLGRVLRFEPSDLSAGELAREYYNQGVKGTFQLIRNLPNYSEDLADGAKVAC LELVEKAKELRHQGNGWWSISMEKSKLVDPPAAGDGPSSHEVILIERPGDVDGFAGDG KVVLKPRTK" misc_feature 179..385 /gene="LOC108060860" /note="MICOS complex subunit MIC13, QIL1; Region: QIL1; pfam15884" /db_xref="CDD:464923" polyA_site 783 /gene="LOC108060860" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 aaagtaggtc tagaatttta ggccaatact aaaaggctaa aagtatttga gccagaacgt 61 gtttggtatt ccttcgagta atcctaagta ttccaaatag ttgtgatccc gaattatgac 121 gacaatgatc accactttga tggcgcgaac ggcggcggtc acgatgacgg tctacatgac 181 gaaccgcatg ggtgtttggg gcaagacgga ggagacggac aggctgctgc agcagatcac 241 cacgggtctc cagccgttgg tcggactttt gggccgcgtg ctgcgtttcg agccgagtga 301 cctcagtgca ggcgaactgg ccagggaata ctacaatcaa ggtgtcaagg gtaccttcca 361 actcatccgc aacctaccca attactcgga agacctggcc gatggggcca aggtcgcctg 421 tctggagctg gtcgaaaagg ccaaggagtt gcgccaccaa ggcaatggct ggtggagtat 481 ttccatggaa aagtccaaac tggtggatcc tcctgctgcc ggcgatggac catcatccca 541 cgaagttatt cttatcgagc ggccggggga tgtagatggc tttgctggcg atggcaaagt 601 tgtcctcaaa ccgaggacaa agtgagggat tagacaccaa caaaatctaa ttcttaaatt 661 tttatgtaaa gtacgagtat ttataccggg attggaaact ccctagcttt aatactctga 721 aagcgaaatt ctaaaaagca tagcgagagc aaaatatatt acctttgtta cgttttaaat 781 tta