Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_017146751 586 bp mRNA linear INV 09-DEC-2024 (LOC108060853), mRNA. ACCESSION XM_017146751 VERSION XM_017146751.3 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Dec 9, 2024 this sequence version replaced XM_017146751.2. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..586 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..586 /gene="LOC108060853" /note="uncharacterized LOC108060853; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 Protein" /db_xref="GeneID:108060853" CDS 88..555 /gene="LOC108060853" /codon_start=1 /product="uncharacterized protein" /protein_id="XP_017002240.1" /db_xref="GeneID:108060853" /translation="MLHSSYNRAPRRKLIPNLFSNILQVIADADHPLTEPEIIEAVAD RLDRSDEELKRQITVSLHDALIYGYLRVKNYRYSIVPSRLDPDDHPHHHPEPSSSIAA TAEHHRVQDRISSGTSAAMDHGHGQDRDRDQEPTPKAAQAVKKVTAESEKQTN" misc_feature 127..324 /gene="LOC108060853" /note="Domain of unknown function (DUF4777); Region: DUF4777; pfam16007" /db_xref="CDD:374290" ORIGIN 1 tatgtgtcac atcgacacgg cccatatatc gttcggaatc aggatcagta tcaccatcag 61 catcggcatc aggatcccag acccaggatg ttgcacagca gctacaaccg ggcacctcgg 121 cgcaagctca ttccgaacct gttcagcaac atcttgcagg tgatcgccga tgcggaccat 181 ccgctaaccg agcccgagat catcgaggcc gtcgccgatc gactggatcg cagcgacgag 241 gagctgaagc gccagataac ggtgagcctc cacgatgccc tgatctacgg ctacctgcgg 301 gtgaagaact atcgttactc gatagttccc agtcgcctgg acccggacga ccatccccac 361 caccatccgg agcccagctc ctcgatcgcc gccaccgcgg aacatcatcg ggtgcaggac 421 aggatctcca gtgggaccag tgcagccatg gatcacggac acggtcagga tcgggatcgg 481 gaccaggaac ccactcccaa ggccgcccag gcggtcaaaa aagtaactgc tgagtcggaa 541 aagcaaacaa attaataaaa taaattttat atggttcaca gacaag