Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii uncharacterized protein


LOCUS       XM_017146751             586 bp    mRNA    linear   INV 09-DEC-2024
            (LOC108060853), mRNA.
ACCESSION   XM_017146751
VERSION     XM_017146751.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017146751.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..586
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..586
                     /gene="LOC108060853"
                     /note="uncharacterized LOC108060853; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 1
                     Protein"
                     /db_xref="GeneID:108060853"
     CDS             88..555
                     /gene="LOC108060853"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_017002240.1"
                     /db_xref="GeneID:108060853"
                     /translation="MLHSSYNRAPRRKLIPNLFSNILQVIADADHPLTEPEIIEAVAD
                     RLDRSDEELKRQITVSLHDALIYGYLRVKNYRYSIVPSRLDPDDHPHHHPEPSSSIAA
                     TAEHHRVQDRISSGTSAAMDHGHGQDRDRDQEPTPKAAQAVKKVTAESEKQTN"
     misc_feature    127..324
                     /gene="LOC108060853"
                     /note="Domain of unknown function (DUF4777); Region:
                     DUF4777; pfam16007"
                     /db_xref="CDD:374290"
ORIGIN      
        1 tatgtgtcac atcgacacgg cccatatatc gttcggaatc aggatcagta tcaccatcag
       61 catcggcatc aggatcccag acccaggatg ttgcacagca gctacaaccg ggcacctcgg
      121 cgcaagctca ttccgaacct gttcagcaac atcttgcagg tgatcgccga tgcggaccat
      181 ccgctaaccg agcccgagat catcgaggcc gtcgccgatc gactggatcg cagcgacgag
      241 gagctgaagc gccagataac ggtgagcctc cacgatgccc tgatctacgg ctacctgcgg
      301 gtgaagaact atcgttactc gatagttccc agtcgcctgg acccggacga ccatccccac
      361 caccatccgg agcccagctc ctcgatcgcc gccaccgcgg aacatcatcg ggtgcaggac
      421 aggatctcca gtgggaccag tgcagccatg gatcacggac acggtcagga tcgggatcgg
      481 gaccaggaac ccactcccaa ggccgcccag gcggtcaaaa aagtaactgc tgagtcggaa
      541 aagcaaacaa attaataaaa taaattttat atggttcaca gacaag