Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii RAS oncogene family member Rab9D


LOCUS       XM_017146746             948 bp    mRNA    linear   INV 09-DEC-2024
            (Rab9D), mRNA.
ACCESSION   XM_017146746
VERSION     XM_017146746.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017146746.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..948
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..948
                     /gene="Rab9D"
                     /note="RAS oncogene family member Rab9D; Derived by
                     automated computational analysis using gene prediction
                     method: Gnomon. Supporting evidence includes similarity
                     to: 6 Proteins"
                     /db_xref="GeneID:108060848"
     CDS             58..732
                     /gene="Rab9D"
                     /codon_start=1
                     /product="uncharacterized protein Rab9D"
                     /protein_id="XP_017002235.2"
                     /db_xref="GeneID:108060848"
                     /translation="MTTDYKYLFKILVLGDCGVGKSCLLMRFSDGRFTGKYLCTVGVD
                     FKVRTVEVAGQVVKLQIWDTAGEERFKSVLPSYYRGAHGILLVYDTTSASSFQGIDGW
                     LEEIRNNCPDRVNVLLVGNKCDDLEHRQVSQQQAAHYADYRALAFREASAKSGANVNH
                     VFAALAVAIFNRLVATPPAPSRMLGGQDKRDEVPEEKEKSPALARKIRLEDHGRLRSK
                     HVKSCC"
     misc_feature    82..555
                     /gene="Rab9D"
                     /note="Ras-related in brain (Rab) family of small
                     guanosine triphosphatases (GTPases); Region: Rab; cd00154"
                     /db_xref="CDD:206640"
     misc_feature    82..87
                     /gene="Rab9D"
                     /note="Rab subfamily motif 1 (RabSF1); other site"
                     /db_xref="CDD:206640"
     misc_feature    100..123
                     /gene="Rab9D"
                     /note="G1 box; other site"
                     /db_xref="CDD:206640"
     misc_feature    order(106..126,154..156,175..177,253..255,418..423,
                     427..429,508..516)
                     /gene="Rab9D"
                     /note="GTP/Mg2+ binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:206640"
     misc_feature    124..156
                     /gene="Rab9D"
                     /note="Rab subfamily motif 2 (RabSF2); other site"
                     /db_xref="CDD:206640"
     misc_feature    order(154..156,175..195)
                     /gene="Rab9D"
                     /note="Switch I region; other site"
                     /db_xref="CDD:206640"
     misc_feature    175..177
                     /gene="Rab9D"
                     /note="G2 box; other site"
                     /db_xref="CDD:206640"
     misc_feature    order(178..180,184..192,235..237,241..243,262..267,
                     274..276,286..288,301..303)
                     /gene="Rab9D"
                     /note="effector interaction site [active]"
                     /db_xref="CDD:206640"
     misc_feature    order(178..183,187..189,241..246,265..267,277..285)
                     /gene="Rab9D"
                     /note="GDI interaction site [active]"
                     /db_xref="CDD:206640"
     misc_feature    178..192
                     /gene="Rab9D"
                     /note="Rab family motif 1 (RabF1); other site"
                     /db_xref="CDD:206640"
     misc_feature    order(181..204,223..225,229..231)
                     /gene="Rab9D"
                     /note="GEF interaction site [polypeptide binding]; other
                     site"
                     /db_xref="CDD:206640"
     misc_feature    229..243
                     /gene="Rab9D"
                     /note="Rab family motif 2 (RabF2); other site"
                     /db_xref="CDD:206640"
     misc_feature    244..255
                     /gene="Rab9D"
                     /note="G3 box; other site"
                     /db_xref="CDD:206640"
     misc_feature    order(253..255,259..270,274..291)
                     /gene="Rab9D"
                     /note="Switch II region; other site"
                     /db_xref="CDD:206640"
     misc_feature    order(262..270,274..279)
                     /gene="Rab9D"
                     /note="Rab family motif 3 (RabF3); other site"
                     /db_xref="CDD:206640"
     misc_feature    286..291
                     /gene="Rab9D"
                     /note="Rab family motif 4 (RabF4); other site"
                     /db_xref="CDD:206640"
     misc_feature    313..330
                     /gene="Rab9D"
                     /note="Rab family motif 5 (RabF5); other site"
                     /db_xref="CDD:206640"
     misc_feature    397..411
                     /gene="Rab9D"
                     /note="Rab subfamily motif 3 (RabSF3); other site"
                     /db_xref="CDD:206640"
     misc_feature    418..429
                     /gene="Rab9D"
                     /note="G4 box; other site"
                     /db_xref="CDD:206640"
     misc_feature    508..516
                     /gene="Rab9D"
                     /note="G5 box; other site"
                     /db_xref="CDD:206640"
ORIGIN      
        1 ctgtcacttt catctatttg acccccctga gatatctggc gactccaatc gatagcaatg
       61 acgaccgact acaagtacct gttcaagatc ctcgtcctgg gcgactgcgg cgtgggcaag
      121 tcctgtctgc tgatgcgctt ctcggacggc cggttcaccg ggaagtacct gtgcacggtg
      181 ggcgtggact tcaaggtgcg caccgtggag gtggccggcc aggtggtgaa gctccagatc
      241 tgggacaccg ccggcgagga gcgcttcaag tcggtgctgc cgtcgtacta tcgcggtgcc
      301 cacggcattc tgctcgtcta cgacaccacg tcggccagca gcttccaggg catcgatggc
      361 tggctggagg agattcggaa caattgcccc gacagggtca acgttctgct ggtgggcaac
      421 aagtgcgacg accttgagca ccgccaggtg agccagcagc aggcggccca ctacgccgac
      481 taccgggctc tcgcctttcg cgaggcctcc gccaagagtg gcgccaatgt gaatcacgta
      541 ttcgccgcgt tggccgttgc catcttcaat cgcctggtgg ccacgccccc agcccccagt
      601 cgcatgctgg gcgggcagga taaaagggac gaagtgccgg aggaaaagga gaagtccccg
      661 gccctggctc gcaaaatccg gctggaggac cacggccgcc tgcggtccaa acatgtcaaa
      721 tcctgctgtt gagaaacttc gtttttatat tttctatatc agtgtttatc tttcttaaag
      781 ttctataact ttaatatttc ataatatatt tttaaaacag acataactca aaatttaaca
      841 agttccagac aaaaaccagt taaaaaccaa acctaagctt tgaaagcaca tgttcaatat
      901 acccgcagaa aagtaattta tctttaagtt tgaaaaaaaa agacattt