Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_017146746 948 bp mRNA linear INV 09-DEC-2024 (Rab9D), mRNA. ACCESSION XM_017146746 VERSION XM_017146746.3 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Dec 9, 2024 this sequence version replaced XM_017146746.2. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..948 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..948 /gene="Rab9D" /note="RAS oncogene family member Rab9D; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 6 Proteins" /db_xref="GeneID:108060848" CDS 58..732 /gene="Rab9D" /codon_start=1 /product="uncharacterized protein Rab9D" /protein_id="XP_017002235.2" /db_xref="GeneID:108060848" /translation="MTTDYKYLFKILVLGDCGVGKSCLLMRFSDGRFTGKYLCTVGVD FKVRTVEVAGQVVKLQIWDTAGEERFKSVLPSYYRGAHGILLVYDTTSASSFQGIDGW LEEIRNNCPDRVNVLLVGNKCDDLEHRQVSQQQAAHYADYRALAFREASAKSGANVNH VFAALAVAIFNRLVATPPAPSRMLGGQDKRDEVPEEKEKSPALARKIRLEDHGRLRSK HVKSCC" misc_feature 82..555 /gene="Rab9D" /note="Ras-related in brain (Rab) family of small guanosine triphosphatases (GTPases); Region: Rab; cd00154" /db_xref="CDD:206640" misc_feature 82..87 /gene="Rab9D" /note="Rab subfamily motif 1 (RabSF1); other site" /db_xref="CDD:206640" misc_feature 100..123 /gene="Rab9D" /note="G1 box; other site" /db_xref="CDD:206640" misc_feature order(106..126,154..156,175..177,253..255,418..423, 427..429,508..516) /gene="Rab9D" /note="GTP/Mg2+ binding site [chemical binding]; other site" /db_xref="CDD:206640" misc_feature 124..156 /gene="Rab9D" /note="Rab subfamily motif 2 (RabSF2); other site" /db_xref="CDD:206640" misc_feature order(154..156,175..195) /gene="Rab9D" /note="Switch I region; other site" /db_xref="CDD:206640" misc_feature 175..177 /gene="Rab9D" /note="G2 box; other site" /db_xref="CDD:206640" misc_feature order(178..180,184..192,235..237,241..243,262..267, 274..276,286..288,301..303) /gene="Rab9D" /note="effector interaction site [active]" /db_xref="CDD:206640" misc_feature order(178..183,187..189,241..246,265..267,277..285) /gene="Rab9D" /note="GDI interaction site [active]" /db_xref="CDD:206640" misc_feature 178..192 /gene="Rab9D" /note="Rab family motif 1 (RabF1); other site" /db_xref="CDD:206640" misc_feature order(181..204,223..225,229..231) /gene="Rab9D" /note="GEF interaction site [polypeptide binding]; other site" /db_xref="CDD:206640" misc_feature 229..243 /gene="Rab9D" /note="Rab family motif 2 (RabF2); other site" /db_xref="CDD:206640" misc_feature 244..255 /gene="Rab9D" /note="G3 box; other site" /db_xref="CDD:206640" misc_feature order(253..255,259..270,274..291) /gene="Rab9D" /note="Switch II region; other site" /db_xref="CDD:206640" misc_feature order(262..270,274..279) /gene="Rab9D" /note="Rab family motif 3 (RabF3); other site" /db_xref="CDD:206640" misc_feature 286..291 /gene="Rab9D" /note="Rab family motif 4 (RabF4); other site" /db_xref="CDD:206640" misc_feature 313..330 /gene="Rab9D" /note="Rab family motif 5 (RabF5); other site" /db_xref="CDD:206640" misc_feature 397..411 /gene="Rab9D" /note="Rab subfamily motif 3 (RabSF3); other site" /db_xref="CDD:206640" misc_feature 418..429 /gene="Rab9D" /note="G4 box; other site" /db_xref="CDD:206640" misc_feature 508..516 /gene="Rab9D" /note="G5 box; other site" /db_xref="CDD:206640" ORIGIN 1 ctgtcacttt catctatttg acccccctga gatatctggc gactccaatc gatagcaatg 61 acgaccgact acaagtacct gttcaagatc ctcgtcctgg gcgactgcgg cgtgggcaag 121 tcctgtctgc tgatgcgctt ctcggacggc cggttcaccg ggaagtacct gtgcacggtg 181 ggcgtggact tcaaggtgcg caccgtggag gtggccggcc aggtggtgaa gctccagatc 241 tgggacaccg ccggcgagga gcgcttcaag tcggtgctgc cgtcgtacta tcgcggtgcc 301 cacggcattc tgctcgtcta cgacaccacg tcggccagca gcttccaggg catcgatggc 361 tggctggagg agattcggaa caattgcccc gacagggtca acgttctgct ggtgggcaac 421 aagtgcgacg accttgagca ccgccaggtg agccagcagc aggcggccca ctacgccgac 481 taccgggctc tcgcctttcg cgaggcctcc gccaagagtg gcgccaatgt gaatcacgta 541 ttcgccgcgt tggccgttgc catcttcaat cgcctggtgg ccacgccccc agcccccagt 601 cgcatgctgg gcgggcagga taaaagggac gaagtgccgg aggaaaagga gaagtccccg 661 gccctggctc gcaaaatccg gctggaggac cacggccgcc tgcggtccaa acatgtcaaa 721 tcctgctgtt gagaaacttc gtttttatat tttctatatc agtgtttatc tttcttaaag 781 ttctataact ttaatatttc ataatatatt tttaaaacag acataactca aaatttaaca 841 agttccagac aaaaaccagt taaaaaccaa acctaagctt tgaaagcaca tgttcaatat 901 acccgcagaa aagtaattta tctttaagtt tgaaaaaaaa agacattt