PREDICTED: Drosophila takahashii uncharacterized protein

LOCUS       XM_017146742             519 bp    mRNA    linear   INV 09-DEC-2024
            (LOC108060845), mRNA.
ACCESSION   XM_017146742
VERSION     XM_017146742.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017146742.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..519
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..519
                     /gene="LOC108060845"
                     /note="uncharacterized LOC108060845; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 3
                     Proteins"
                     /db_xref="GeneID:108060845"
     CDS             171..461
                     /gene="LOC108060845"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_017002231.2"
                     /db_xref="GeneID:108060845"
                     /translation="MPVAYKTRTLPRQRGLVPNLLRSILHVLEEAHRPMSDAELVQVL
                     GLQYRRSDPEFNRQVQMNLRDGVEYGILRRQRNLFSLRSRRLGELMATLGPS"
     misc_feature    216..413
                     /gene="LOC108060845"
                     /note="Domain of unknown function (DUF4777); Region:
                     DUF4777; pfam16007"
                     /db_xref="CDD:374290"
     polyA_site      519
                     /gene="LOC108060845"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 ctcattcaca acgactgaga ccggcctgcg agtcggtcac aaaaattttc tacactttct
       61 acattcggtt ttggcaaaac aaaaaaaact caaaaaaaaa aaaataaaaa aaaagatcta
      121 taaaaaaaag cacaatacac atttggatat agattcggtt taacactaac atgccggttg
      181 cctacaagac acgcacactg ccccggcaga gaggactggt gcccaaccta ctgcggtcca
      241 tcctacacgt cctggaggag gcccaccgac ccatgagcga cgccgagctg gtccaagtcc
      301 tggggctcca gtaccgccgc agcgatcccg agttcaaccg ccaggtgcag atgaatctgc
      361 gcgatggcgt cgagtacggc atcctgaggc gtcagcggaa cctcttctcg ctgcgctcgc
      421 gacgcctggg cgagctgatg gccactctgg gaccctctta gccatgccac tgggaaacga
      481 cgcactacaa gatcggaatg cagccccccc ccccccgaa