Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii uncharacterized protein


LOCUS       XM_017146741             422 bp    mRNA    linear   INV 09-DEC-2024
            (LOC108060843), mRNA.
ACCESSION   XM_017146741
VERSION     XM_017146741.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017146741.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..422
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..422
                     /gene="LOC108060843"
                     /note="uncharacterized LOC108060843; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 1
                     Protein"
                     /db_xref="GeneID:108060843"
     CDS             26..358
                     /gene="LOC108060843"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_017002230.2"
                     /db_xref="GeneID:108060843"
                     /translation="MHNRSRSMWLVAAVLLALLLPEALPTADAVSEPVCSYRNSEDET
                     IFLKYLPLLRRGQDYVDFGKDGKCLKRAICTDTFKTIVEDCAQQKITCVNKDRFTGVF
                     PACCLKCP"
     polyA_site      422
                     /gene="LOC108060843"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 tcagtctcgc ttccacgtcc caaagatgca caacagatcc agatccatgt ggctggtggc
       61 cgctgtgctg ctggcgctcc tgctcccgga ggcgctgccc accgccgatg cggtgagcga
      121 gcccgtgtgc tcctaccgca actcggagga tgagaccatc ttcctcaagt acctgccgct
      181 cctgcggcgc ggacaggact acgtggactt cggcaaggac ggcaagtgcc tcaagcgggc
      241 catctgcacg gacaccttca agaccatcgt ggaggattgc gcccagcaga agatcacgtg
      301 tgtgaacaag gatcgcttta cgggcgtttt tcctgcttgc tgcctcaagt gtccttaaat
      361 tggaaaattt gtcttgcttg gatggtacat aaataaattc cgtgtaatac atacaatcca
      421 aa