Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_017146734 1083 bp mRNA linear INV 09-DEC-2024 (LOC108060837), transcript variant X1, mRNA. ACCESSION XM_017146734 VERSION XM_017146734.3 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Dec 9, 2024 this sequence version replaced XM_017146734.2. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..1083 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..1083 /gene="LOC108060837" /note="uncharacterized LOC108060837; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 Protein" /db_xref="GeneID:108060837" CDS 223..957 /gene="LOC108060837" /codon_start=1 /product="uncharacterized protein isoform X1" /protein_id="XP_017002223.3" /db_xref="GeneID:108060837" /translation="MKCFFILIATSLVLSAWAQDAAESDLEQVASASAPEAVAVEDQV SAASSYAPLQDKKQEKRYVGGYGGYGAGYGGYGGAGYGAGYGAGYGGYGSGLAAGYAG AYGSGVGVDGYYNPYGSRSLGGLGEDGAGYGGYGSALGGYGSGLGGYGSALGGGYGSG LGGYAGSYNSNPYALSYYNSRLGAGAGTGYPYYNTRFGAGGYPSSYYTSNYGNSVVGG GLGALGGVPPIGSGYNYGSGISGTVY" polyA_site 1083 /gene="LOC108060837" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 ggcaaaacaa aacaaatcta tgagatgcag cagtggtttg agccactggg ctccaacttc 61 gctgggattg gaattgggtt cgttgctcgg cgggtataaa agcgactgct gggccggcag 121 tggaatcatt agacaagtgt cgaacggcgc gtgcgcaaca gagtcttaga ggagcagtta 181 gccaccagcg atcagtgaac accacaaaca ggcggccaca acatgaagtg ctttttcatc 241 ctgatagcga cgagcctggt gctcagtgcc tgggcccagg acgcggcgga gtctgacctg 301 gagcaggtgg cctcggcatc ggctccggag gcggtggcag tggaggatca ggtgagcgcc 361 gccagcagct atgcgccgct gcaggataag aagcaggaga agcgatatgt tggtggatac 421 ggtggctacg gggcaggata cggcggctac ggaggagctg gatacggagc aggatatggg 481 gcaggatacg ggggctatgg ctctggcctg gcagccggtt acgcaggagc ctacggcagt 541 ggcgtcggag tggacggcta ctacaacccg tacggttcgc gatctctggg tggactaggt 601 gaggatggcg ccggctatgg cggctatgga tctgccctcg gtggctatgg atccggcctg 661 ggaggctatg gttctgccct cggtggcggc tatggatcgg gactgggagg ctatgccggc 721 tcctacaact cgaatcccta tgcgctgtcc tactacaaca gcaggctggg cgccggagcc 781 ggcactggtt atccgtacta caacacccgg ttcggcgccg gcggataccc gtccagctac 841 tacacgagca actacggcaa cagcgtggtg ggcggtggcc tgggcgccct gggcggagtg 901 ccgcccatcg gatcggggta caactacgga tccggcatct cgggcaccgt ctactagaag 961 gagctgggga gctgtcgacg caacgttcaa gatctaagct agtggaattt attttttttc 1021 ttcgataact ttattttttt ctaactttat ttttattaaa agatgctata aaacaaaaaa 1081 aaa