Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_017146724 651 bp mRNA linear INV 09-DEC-2024 (LOC108060832), mRNA. ACCESSION XM_017146724 VERSION XM_017146724.3 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Dec 9, 2024 this sequence version replaced XM_017146724.2. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..651 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..651 /gene="LOC108060832" /note="uncharacterized LOC108060832; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 2 Proteins" /db_xref="GeneID:108060832" CDS 125..499 /gene="LOC108060832" /codon_start=1 /product="uncharacterized protein" /protein_id="XP_017002213.2" /db_xref="GeneID:108060832" /translation="MSPERFAIPTVIAAGALLFSMLAQVSGYSGLIPPDADNPGKCVY RGDVLELGVNNGISPCQRLTCNADGSILIEGCGKLRIENCNHGERILPSEPFPECCKL RYKCKQVGAAPYYIERNTFEKV" misc_feature 248..442 /gene="LOC108060832" /note="Single domain von Willebrand factor type C; Region: SVWC; pfam15430" /db_xref="CDD:464713" polyA_site 651 /gene="LOC108060832" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 tggaagcgtg acggcgacga ctcagctcgg caatctcaac gagtatgccc tatgtgcgga 61 gtagacaacg ccgatcggag tccgggtcca agtcagtcca gttttgagca cgaacacggt 121 cgcaatgtct ccggagcgct tcgcaattcc aacagtaatc gcagcaggcg ccctgctttt 181 ttcgatgctg gctcaggtga gcggctactc gggcctgatt ccaccggatg cagataatcc 241 cggcaagtgc gtttaccgcg gcgacgtcct ggagttgggt gtcaacaatg gcatttcgcc 301 ctgccagcgg ctaacgtgca acgcggatgg ctcaatactt atcgagggat gcggaaagct 361 gcgcatcgag aactgcaatc atggcgagcg catcctgccc agcgaaccct tcccggagtg 421 ctgcaaactg cggtacaagt gcaagcaggt cggagcggcg ccctactaca tcgagcggaa 481 tacattcgag aaggtctagg aggatttccc gggatttccg agggggagga gccccaccaa 541 agccaaggac gccttcaatc tttcgcagat ccaacataca tataatcaac aacttgctaa 601 tttatttgtc atcttgtatt tctcaataag caccatgttt tgtttttttt t