Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_017146721 1091 bp mRNA linear INV 09-DEC-2024 phosphoprotein (LOC108060828), mRNA. ACCESSION XM_017146721 VERSION XM_017146721.2 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Oct 18, 2021 this sequence version replaced XM_017146721.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..1091 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..1091 /gene="LOC108060828" /note="28 kDa heat- and acid-stable phosphoprotein; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 2 Proteins" /db_xref="GeneID:108060828" CDS 203..850 /gene="LOC108060828" /codon_start=1 /product="28 kDa heat- and acid-stable phosphoprotein" /protein_id="XP_017002210.2" /db_xref="GeneID:108060828" /translation="MPRGKFVNHKGRSRHFTSPEELQQESEEESDQTSGSGSESEEKA GAASSSAKAKAPAPRKAPQNRSQKARNAAGGAASSSDSESGEDSDEDSEGEARDAKKG VASLIEIENPNRVTKKATQKLSAIKLDDGPPGGEGAKGGGHPKPELSRREREQIEKQK ARQRYEKLHAAGKTTEAKADLARLALIRQQREEAAAKREAEKKAADGGAKKPGAK" misc_feature 533..772 /gene="LOC108060828" /note="Casein kinase substrate phosphoprotein PP28; Region: PP28; pfam10252" /db_xref="CDD:463025" polyA_site 1091 /gene="LOC108060828" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 aatcatcgct gtttctccac ctccatgcga aataagtcaa atttttttta tagccaacgt 61 gattatattt agcctatttt cgagggattc gacggcttta gcggtcgttt agcaaggaca 121 aggaacagcc gacggcagtt agcaaggcgg gaatcgagtc gcgagcaggc aaccccccag 181 atcaggccgt agatcgatca gcatgccacg aggaaagttc gtcaaccaca agggccgcag 241 tcgccacttc acatcgccgg aggagctgca gcaggagtcg gaggaggaga gcgaccagac 301 cagcggctcg ggctccgaga gcgaggagaa ggcgggagcc gccagttcct ccgccaaagc 361 caaggcgcca gcgccccgaa aagcccccca gaatcgcagc cagaaggcaa gaaacgcggc 421 gggcggagca gccagttcct ccgactccga gtccggcgag gattccgacg aggattcgga 481 gggcgaggcg cgcgacgcca agaagggcgt ggcctcgctc atcgagatcg agaatcccaa 541 tcgggtgaca aagaaggcca cacagaagct ctcggcgatc aagctggacg acgggccgcc 601 gggcggcgag ggagccaagg gtggcggcca tccgaagccg gagctgtcgc gccgcgaacg 661 ggaacagatc gagaagcaga aggcgcgcca gcggtacgag aagctccatg ccgccggcaa 721 gaccaccgag gcgaaggccg acctcgcccg cttggccctc atccggcagc agcgcgagga 781 ggcggccgcc aagcgggagg ccgagaagaa ggccgccgac ggcggcgcca agaagccggg 841 cgccaagtag agatgaagca tccctccctt gaatccaatc caatccaatc caatccccta 901 acccagaatc cccagaaaat gctacccatt gagctctcaa tccctggaaa acgcaggact 961 attatggcaa ttagttaagc ataaattaac gtaacacaca cacacacatt caaaattatt 1021 caagttttct aagcctgtct tttgtaactg caaattatac aaaaataaac caacttattg 1081 taaaaagcaa a