PREDICTED: Drosophila takahashii uncharacterized protein

LOCUS       XM_017146719             399 bp    mRNA    linear   INV 09-DEC-2024
            (LOC108060826), mRNA.
ACCESSION   XM_017146719
VERSION     XM_017146719.2
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq; includes ab initio.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Oct 18, 2021 this sequence version replaced XM_017146719.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
            
            ##RefSeq-Attributes-START##
            ab initio :: 100% of CDS bases
            ##RefSeq-Attributes-END##
FEATURES             Location/Qualifiers
     source          1..399
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..399
                     /gene="LOC108060826"
                     /note="uncharacterized LOC108060826; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 1
                     Protein"
                     /db_xref="GeneID:108060826"
     CDS             1..399
                     /gene="LOC108060826"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_017002208.2"
                     /db_xref="GeneID:108060826"
                     /translation="MNPFRPRLNANHRLNLERGTNIPGEMERRQERSVDGSVDDSVER
                     QLRLTPRPVIRLVRDHQIDVERFVFNMNNLMDLQRENMRRGAGDGVYVWNMRPILNYN
                     GQLGEGDNDHYGDFNLEVDQEELQGPDPLA"
ORIGIN      
        1 atgaacccct ttcgaccacg tttgaatgcg aatcatcgct tgaacttgga acgtggaacc
       61 aatatacccg gcgaaatgga gcgtcgccag gagagatcgg tggacggatc ggtggacgat
      121 tcggtggaga gacagctgcg actcacccca agaccggtga ttcgattggt gcgggatcac
      181 cagattgacg tggagcgttt cgtattcaac atgaacaacc tgatggatct gcagagggag
      241 aacatgcgcc gcggtgccgg cgatggagtc tacgtgtgga acatgcggcc aattctgaac
      301 tacaacggtc agttgggcga aggcgacaac gatcattacg gcgattttaa tctcgaggtt
      361 gatcaagaag agctgcaggg accggatcca ctggcctag