Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii microtubule-associated protein


LOCUS       XM_017146717             588 bp    mRNA    linear   INV 09-DEC-2024
            RP/EB family member 1-like (LOC108060823), mRNA.
ACCESSION   XM_017146717
VERSION     XM_017146717.2
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq; includes ab initio.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Oct 18, 2021 this sequence version replaced XM_017146717.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
            
            ##RefSeq-Attributes-START##
            ab initio :: 100% of CDS bases
            ##RefSeq-Attributes-END##
FEATURES             Location/Qualifiers
     source          1..588
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..588
                     /gene="LOC108060823"
                     /note="microtubule-associated protein RP/EB family member
                     1-like; Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 2 Proteins"
                     /db_xref="GeneID:108060823"
     CDS             1..588
                     /gene="LOC108060823"
                     /codon_start=1
                     /product="microtubule-associated protein RP/EB family
                     member 1-like"
                     /protein_id="XP_017002206.1"
                     /db_xref="GeneID:108060823"
                     /translation="MEKLEAHMKVSKIVREWVNEKLNTDIQCIEELCSGAIYCQFLDM
                     IFEKVVPMKDVIFETNEIAHFRKNFAVLQQCFHELQIPLEIPVEKLVWCDFDANLNFA
                     AKFYNVFKELSTKNQLRQEKYNALAARNYHKFSLAAPTFVSRGHDACKSPRAEICQLD
                     LELKKADKDVVNEDLTQLEPKDHKSTMKSISFVIP"
     misc_feature    49..>390
                     /gene="LOC108060823"
                     /note="Microtubule-binding protein involved in cell cycle
                     control [Cell division and chromosome partitioning /
                     Cytoskeleton]; Region: BIM1; COG5217"
                     /db_xref="CDD:227542"
ORIGIN      
        1 atggagaagc tggaggctca tatgaaagtt tccaaaatag ttcgcgagtg ggtgaatgag
       61 aagctcaaca ccgatatcca gtgcatagag gaattgtgct caggggccat ttactgtcag
      121 tttctggaca tgatttttga gaaagtcgtc cccatgaagg atgttatttt cgagacaaat
      181 gaaatcgctc atttcaggaa gaactttgca gtgttgcagc aatgttttca tgaactgcag
      241 attcccctgg agattccagt cgaaaagctg gtttggtgtg acttcgacgc caacctgaac
      301 ttcgccgcaa agttctacaa tgtctttaag gaacttagca cgaaaaatca gcttcgtcag
      361 gagaaataca atgcactggc tgcccggaac taccacaaat tctcgctcgc agcacccact
      421 tttgtttccc gtggccacga tgcctgcaaa tccccacgag ctgaaatatg ccaactagat
      481 ctggagctga agaaagccga taaagacgtc gtaaacgagg acttgaccca gttggagccg
      541 aaggaccata aaagcaccat gaagtccatc agctttgtta taccctag