Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_017146717 588 bp mRNA linear INV 09-DEC-2024 RP/EB family member 1-like (LOC108060823), mRNA. ACCESSION XM_017146717 VERSION XM_017146717.2 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq; includes ab initio. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Oct 18, 2021 this sequence version replaced XM_017146717.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## ##RefSeq-Attributes-START## ab initio :: 100% of CDS bases ##RefSeq-Attributes-END## FEATURES Location/Qualifiers source 1..588 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..588 /gene="LOC108060823" /note="microtubule-associated protein RP/EB family member 1-like; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 2 Proteins" /db_xref="GeneID:108060823" CDS 1..588 /gene="LOC108060823" /codon_start=1 /product="microtubule-associated protein RP/EB family member 1-like" /protein_id="XP_017002206.1" /db_xref="GeneID:108060823" /translation="MEKLEAHMKVSKIVREWVNEKLNTDIQCIEELCSGAIYCQFLDM IFEKVVPMKDVIFETNEIAHFRKNFAVLQQCFHELQIPLEIPVEKLVWCDFDANLNFA AKFYNVFKELSTKNQLRQEKYNALAARNYHKFSLAAPTFVSRGHDACKSPRAEICQLD LELKKADKDVVNEDLTQLEPKDHKSTMKSISFVIP" misc_feature 49..>390 /gene="LOC108060823" /note="Microtubule-binding protein involved in cell cycle control [Cell division and chromosome partitioning / Cytoskeleton]; Region: BIM1; COG5217" /db_xref="CDD:227542" ORIGIN 1 atggagaagc tggaggctca tatgaaagtt tccaaaatag ttcgcgagtg ggtgaatgag 61 aagctcaaca ccgatatcca gtgcatagag gaattgtgct caggggccat ttactgtcag 121 tttctggaca tgatttttga gaaagtcgtc cccatgaagg atgttatttt cgagacaaat 181 gaaatcgctc atttcaggaa gaactttgca gtgttgcagc aatgttttca tgaactgcag 241 attcccctgg agattccagt cgaaaagctg gtttggtgtg acttcgacgc caacctgaac 301 ttcgccgcaa agttctacaa tgtctttaag gaacttagca cgaaaaatca gcttcgtcag 361 gagaaataca atgcactggc tgcccggaac taccacaaat tctcgctcgc agcacccact 421 tttgtttccc gtggccacga tgcctgcaaa tccccacgag ctgaaatatg ccaactagat 481 ctggagctga agaaagccga taaagacgtc gtaaacgagg acttgaccca gttggagccg 541 aaggaccata aaagcaccat gaagtccatc agctttgtta taccctag