Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_017146715 768 bp mRNA linear INV 09-DEC-2024 mRNA. ACCESSION XM_017146715 VERSION XM_017146715.2 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq; includes ab initio. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Oct 18, 2021 this sequence version replaced XM_017146715.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## ##RefSeq-Attributes-START## ab initio :: 4% of CDS bases ##RefSeq-Attributes-END## FEATURES Location/Qualifiers source 1..768 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..768 /gene="LOC108060821" /note="venom allergen-1; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 3 Proteins" /db_xref="GeneID:108060821" CDS 1..768 /gene="LOC108060821" /codon_start=1 /product="venom allergen-1" /protein_id="XP_017002204.2" /db_xref="GeneID:108060821" /translation="MTRFQSSPLAIHLFLVLTATLATGQNYCDSSLCPNGRHVACQSS GRFVSGCSGEFVQVDRYIQQILQLHNDRRNLIAGGGVSGFPSALHMGTMAWDATLAQV AAYNALQCRMAHDECRNTNTYRYAGQNLSILFTRSVDIADFLRQRIAAWFDENRDATS ADMENYQMRGGPAIGHFTTMVNERNNRVGCAIARFTDANNVQATLLVCNYAVTNVLNN PVYRAGPAASECTTGRNANYPNLCSPNEVYNYNQWSG" misc_feature 184..633 /gene="LOC108060821" /note="Eukaryotic CAP (cysteine-rich secretory proteins, antigen 5, and pathogenesis-related 1 proteins) domain proteins; Region: CAP_euk; cd05380" /db_xref="CDD:349399" ORIGIN 1 atgacacgtt tccaatcgtc acctttggct atccacttat ttttggtcct aacggccact 61 ttggcgactg gccaaaacta ttgcgactct tcgctctgtc cgaatggaag acatgtcgcc 121 tgtcagagca gcgggcgctt cgtcagcggc tgcagcggtg agtttgtgca ggtggaccgc 181 tacatccagc agatcctgca gctgcacaac gaccgtcgca atttgatcgc cggcggtgga 241 gtgagcggct ttcccagcgc cctgcacatg ggcacgatgg cctgggatgc gacgctggcc 301 caagtggccg cctacaatgc gctgcagtgc cgcatggcgc acgacgagtg ccgcaacacc 361 aacacctatc gctatgcggg ccagaacctc agcattctgt tcacgaggag cgtggatata 421 gccgactttc tgcgccagcg gatagcagcc tggttcgatg agaatcgcga cgcaacgagt 481 gccgatatgg agaattatca gatgcgcggt ggaccggcaa ttgggcactt tacgaccatg 541 gtgaacgagc gcaacaaccg agtgggctgt gcaatcgccc gatttacgga cgccaacaac 601 gtgcaggcca ccctgctggt ctgcaactac gccgtcacga atgtcctgaa caatcccgtc 661 tatcgcgcgg gtcctgccgc ctccgagtgc acaacgggcc ggaacgccaa ctaccccaac 721 ctctgctccc ccaacgaggt ctacaactac aaccagtggt cgggatag