Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii venom allergen-1 (LOC108060821),


LOCUS       XM_017146715             768 bp    mRNA    linear   INV 09-DEC-2024
            mRNA.
ACCESSION   XM_017146715
VERSION     XM_017146715.2
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq; includes ab initio.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Oct 18, 2021 this sequence version replaced XM_017146715.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
            
            ##RefSeq-Attributes-START##
            ab initio :: 4% of CDS bases
            ##RefSeq-Attributes-END##
FEATURES             Location/Qualifiers
     source          1..768
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..768
                     /gene="LOC108060821"
                     /note="venom allergen-1; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 3
                     Proteins"
                     /db_xref="GeneID:108060821"
     CDS             1..768
                     /gene="LOC108060821"
                     /codon_start=1
                     /product="venom allergen-1"
                     /protein_id="XP_017002204.2"
                     /db_xref="GeneID:108060821"
                     /translation="MTRFQSSPLAIHLFLVLTATLATGQNYCDSSLCPNGRHVACQSS
                     GRFVSGCSGEFVQVDRYIQQILQLHNDRRNLIAGGGVSGFPSALHMGTMAWDATLAQV
                     AAYNALQCRMAHDECRNTNTYRYAGQNLSILFTRSVDIADFLRQRIAAWFDENRDATS
                     ADMENYQMRGGPAIGHFTTMVNERNNRVGCAIARFTDANNVQATLLVCNYAVTNVLNN
                     PVYRAGPAASECTTGRNANYPNLCSPNEVYNYNQWSG"
     misc_feature    184..633
                     /gene="LOC108060821"
                     /note="Eukaryotic CAP (cysteine-rich secretory proteins,
                     antigen 5, and pathogenesis-related 1 proteins) domain
                     proteins; Region: CAP_euk; cd05380"
                     /db_xref="CDD:349399"
ORIGIN      
        1 atgacacgtt tccaatcgtc acctttggct atccacttat ttttggtcct aacggccact
       61 ttggcgactg gccaaaacta ttgcgactct tcgctctgtc cgaatggaag acatgtcgcc
      121 tgtcagagca gcgggcgctt cgtcagcggc tgcagcggtg agtttgtgca ggtggaccgc
      181 tacatccagc agatcctgca gctgcacaac gaccgtcgca atttgatcgc cggcggtgga
      241 gtgagcggct ttcccagcgc cctgcacatg ggcacgatgg cctgggatgc gacgctggcc
      301 caagtggccg cctacaatgc gctgcagtgc cgcatggcgc acgacgagtg ccgcaacacc
      361 aacacctatc gctatgcggg ccagaacctc agcattctgt tcacgaggag cgtggatata
      421 gccgactttc tgcgccagcg gatagcagcc tggttcgatg agaatcgcga cgcaacgagt
      481 gccgatatgg agaattatca gatgcgcggt ggaccggcaa ttgggcactt tacgaccatg
      541 gtgaacgagc gcaacaaccg agtgggctgt gcaatcgccc gatttacgga cgccaacaac
      601 gtgcaggcca ccctgctggt ctgcaactac gccgtcacga atgtcctgaa caatcccgtc
      661 tatcgcgcgg gtcctgccgc ctccgagtgc acaacgggcc ggaacgccaa ctaccccaac
      721 ctctgctccc ccaacgaggt ctacaactac aaccagtggt cgggatag