Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii discontinuous actin hexagon (dah),


LOCUS       XM_017145993            2337 bp    mRNA    linear   INV 09-DEC-2024
            mRNA.
ACCESSION   XM_017145993
VERSION     XM_017145993.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017145993.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..2337
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..2337
                     /gene="dah"
                     /note="discontinuous actin hexagon; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 10
                     Proteins"
                     /db_xref="GeneID:108060329"
     CDS             106..2034
                     /gene="dah"
                     /codon_start=1
                     /product="uncharacterized protein dah"
                     /protein_id="XP_017001482.2"
                     /db_xref="GeneID:108060329"
                     /translation="MLGMSVPVQLTKMRNSAEAVATIAREKQIKTQGQGQQVAKDFDL
                     TTIMEQLQRDYADYKYTVYRCASKLVALQKIFHTGKIPYKLLLAILERHNLNGGGLEL
                     MVPPFQLTSLLHDVYFASEKLGHFQQDSSSYQLERSTSLLANFFWNVYDPHRRHSISL
                     LEIKITFILLCKLFSSDHLIGDFFALLADPKSQIISRYAFEQLLSTLGKLLGYLGESK
                     AYGLHNLPLALEQSFARCPHGVGGLTESQFHKLWTAGQTRFLIYGNLLSLVKRIEDTE
                     SLIHSNSCAGCRREHIVGIRFRCQVCRDVSLCLPCFAVGFAGGRHEPGHRMCEVFVED
                     QPPLRWTRHLARLCGWLTMPGRKTQPEEERRGFCNAQESGAASVVTPIPAETRSVRSQ
                     CQEKDRTVILQQQELCSLTGLASKASSRLQSIIDRLLLQNAKLESQLQTVQTASSSEI
                     SLFLSAHQSFLLQIIEDMRQLSHSSVAASPPLPAPPVAPPVAPLVSSTFLSSSTPQRQ
                     IFDMYAPVGANLTHSINGADLNRSYLEANKSDYSLNDISLWFDQRRSSVQPGPGSLPA
                     PLPLPMPLGALLEQKQQPTNGGDTEMVNFKLLLHKVKEIVEDSYSDNAELSAATQNLE
                     NVLDSIIKGEEQHRRIST"
     misc_feature    349..864
                     /gene="dah"
                     /note="EF-hand-like motif found in the
                     dystrophin/dystrobrevin/dystrotelin family; Region:
                     EFh_DMD_DYTN_DTN; cl07621"
                     /db_xref="CDD:352774"
     misc_feature    349..471
                     /gene="dah"
                     /note="EF-hand-like motif [structural motif]; Region:
                     EF-hand-like motif"
                     /db_xref="CDD:319999"
     misc_feature    508..612
                     /gene="dah"
                     /note="EF-hand-like motif [structural motif]; Region:
                     EF-hand-like motif"
                     /db_xref="CDD:319999"
     misc_feature    631..744
                     /gene="dah"
                     /note="EF-hand-like motif [structural motif]; Region:
                     EF-hand-like motif"
                     /db_xref="CDD:319999"
     misc_feature    781..864
                     /gene="dah"
                     /note="EF-hand-like motif [structural motif]; Region:
                     EF-hand-like motif"
                     /db_xref="CDD:319999"
     misc_feature    949..1095
                     /gene="dah"
                     /note="Zinc finger, ZZ type. Zinc finger present in
                     Drosophila dah and related proteins. The ZZ motif
                     coordinates two zinc ions and most likely participates in
                     ligand binding or molecular scaffolding. Dah
                     (discontinuous actin hexagon) is a membrane associated...;
                     Region: ZZ_dah; cd02345"
                     /db_xref="CDD:239085"
     misc_feature    order(955..957,964..966,1000..1002,1009..1011,1027..1029,
                     1036..1038,1066..1068,1078..1080)
                     /gene="dah"
                     /note="Zinc-binding sites [ion binding]; other site"
                     /db_xref="CDD:239085"
     misc_feature    order(955..957,964..966,1027..1029,1036..1038)
                     /gene="dah"
                     /note="zinc cluster 1 [ion binding]; other site"
                     /db_xref="CDD:239085"
     misc_feature    order(958..960,991..993,997..999,1015..1017,1021..1023)
                     /gene="dah"
                     /note="putative charged binding surface [active]"
                     /db_xref="CDD:239085"
     misc_feature    order(994..996,1039..1041,1084..1086,1093..1095)
                     /gene="dah"
                     /note="putative hydrophobic binding surface [active]"
                     /db_xref="CDD:239085"
     misc_feature    order(1000..1002,1009..1011,1066..1068,1078..1080)
                     /gene="dah"
                     /note="zinc cluster 2 [ion binding]; other site"
                     /db_xref="CDD:239085"
     polyA_site      2337
                     /gene="dah"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 atttgatatt taacggaagg caagaggaag agcgatcgcg aaaagcgacg cggttaaagg
       61 aaatagaaaa cctgggaaat tacacaaaaa ccaagtgatt gcaaaatgct gggaatgtcg
      121 gtgcccgtgc agctgaccaa gatgcgcaac agcgccgagg cggtggccac catagccagg
      181 gagaagcaaa taaaaaccca aggacaaggg caacaggtgg ccaaggattt cgatttgacc
      241 acgataatgg agcaactgca gcgggattac gcggattaca agtacacggt ctaccgctgt
      301 gccagtaaat tggtggccct gcaaaagata ttccacacgg gaaagattcc ctataaactt
      361 cttttggcca ttctggagcg gcacaacctg aacggcggcg gcctggagct gatggtgccg
      421 cccttccagc tgacctcgct cctccacgac gtctactttg ccagcgagaa gctgggacac
      481 tttcagcagg attcgtcttc ctaccaattg gagagatcca ccagcctgct ggccaacttc
      541 ttctggaatg tctacgatcc acaccgccga cattcgattt ccctgctgga gatcaagatc
      601 accttcatcc tgctgtgcaa gctctttagc agcgatcatc tgatcggcga cttcttcgcc
      661 ctgctcgccg atcccaagtc gcagatcatc tcgcgctacg ccttcgagca gctcctctcc
      721 acgctgggca agctactcgg ctatttgggc gagtccaagg cctatggcct ccacaatttg
      781 ccgctggctt tggagcagag cttcgcccgc tgtccacatg gcgtcggtgg attgacggag
      841 tcgcagttcc acaaactctg gacggccgga cagacgcgct tcctcatcta cggcaatctg
      901 ctgtcgctgg tcaaacgcat cgaggatacg gagagcctga tacacagcaa ctcgtgtgcc
      961 ggctgccgca gggagcacat tgtgggcatt cgctttaggt gccaggtgtg ccgcgatgtc
     1021 tccctgtgcc tgccctgctt tgccgtgggc tttgccggcg gccgccatga gccggggcat
     1081 cggatgtgcg aggttttcgt cgaggatcag ccgccgctgc gttggacccg ccatttggcc
     1141 aggctgtgcg gctggctgac gatgcccggg cgcaaaacgc agccggagga ggagcgtcgc
     1201 ggcttctgca atgcccagga gagcggtgcc gcctccgtgg tcactccgat tcccgccgag
     1261 acgcgcagtg tgcgtagtca gtgccaggag aaggatcgca ctgtgatcct tcagcagcag
     1321 gagctctgct cgctcaccgg actggccagc aaggcctcct caaggctgca gtccatcatc
     1381 gatcgcctgc tgctgcagaa tgcgaaactg gagagccagc tgcaaacggt gcaaaccgcc
     1441 tcgagttcgg aaatctcgct gtttctcagc gcccatcaga gtttcctgct gcagatcatc
     1501 gaggatatgc ggcagctatc gcactcgtct gtggctgcct cgccacctct gccggctcct
     1561 ccagtggccc ctccggtggc tcccctggtc agctccacct tcctcagctc cagcacgccg
     1621 caaaggcaga tcttcgatat gtacgcaccc gttggcgcca atctcacgca ctccataaat
     1681 ggcgccgacc tgaatcgcag ctacttggag gccaacaagt cggactattc cctgaacgac
     1741 atcagcctgt ggttcgatca gcgtcgctcg agcgtgcagc cggggcctgg atccctgcct
     1801 gctcctctgc cgctgcccat gccgctgggc gccctgctgg aacagaaaca gcagccaacg
     1861 aacggcggcg acaccgagat ggtgaacttc aagctgctgc ttcacaaggt caaggagatc
     1921 gtcgaggact cgtacagcga caatgccgag ctgtcggcgg ccacacagaa tctggagaac
     1981 gtcctcgaca gcatcatcaa gggcgaggag cagcatcggc gcatcagcac gtgaggagga
     2041 gcggtgacgt ccctcaaatc gattccagcc agaccaagtc cacctagctt taagttgtaa
     2101 attttgatta taatcccgag acaatgattg atccaatcgt tttccaaaat gcttcaagtt
     2161 gagtagatcc taagtcctct gacaatgcaa tatcataaat tgtttatata aaagaaacaa
     2221 aaaacattta agaaacggaa tatattatac aattttaaga tatattccca gtttaaataa
     2281 atactgaaac aaccagatat cataaattta ataaaatata ttcaaaaatt ctttaaa