Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_017145953 320 bp mRNA linear INV 09-DEC-2024 (LOC108060309), mRNA. ACCESSION XM_017145953 VERSION XM_017145953.3 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Dec 9, 2024 this sequence version replaced XM_017145953.2. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..320 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..320 /gene="LOC108060309" /note="uncharacterized LOC108060309; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 Protein" /db_xref="GeneID:108060309" CDS 135..254 /gene="LOC108060309" /codon_start=1 /product="uncharacterized protein" /protein_id="XP_017001442.1" /db_xref="GeneID:108060309" /translation="MNTDRLILLQFSMHCFKIIFIYCICVNVLEHLVQRVQEN" polyA_site 320 /gene="LOC108060309" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 tttcactttg cctgtaacgt caaaattgat ttgttctaag aaactaacaa aaaatgtgga 61 aataagctgc cgttcttaat ttttggaagc aatatccctc gatttcgagc tctccaagct 121 ccaagcgatc caccatgaac actgatcgcc tgatcctgct gcagttcagc atgcactgct 181 tcaagatcat cttcatctac tgcatctgcg tgaatgtcct ggagcatctc gtccagcggg 241 tccaggaaaa ctgagcggaa aaatgttggg ggccgcgaaa aagggatcaa taaaaattaa 301 gcggcacttg ttttgaaaaa