Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii uncharacterized protein


LOCUS       XM_017145953             320 bp    mRNA    linear   INV 09-DEC-2024
            (LOC108060309), mRNA.
ACCESSION   XM_017145953
VERSION     XM_017145953.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017145953.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..320
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..320
                     /gene="LOC108060309"
                     /note="uncharacterized LOC108060309; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 1
                     Protein"
                     /db_xref="GeneID:108060309"
     CDS             135..254
                     /gene="LOC108060309"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_017001442.1"
                     /db_xref="GeneID:108060309"
                     /translation="MNTDRLILLQFSMHCFKIIFIYCICVNVLEHLVQRVQEN"
     polyA_site      320
                     /gene="LOC108060309"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 tttcactttg cctgtaacgt caaaattgat ttgttctaag aaactaacaa aaaatgtgga
       61 aataagctgc cgttcttaat ttttggaagc aatatccctc gatttcgagc tctccaagct
      121 ccaagcgatc caccatgaac actgatcgcc tgatcctgct gcagttcagc atgcactgct
      181 tcaagatcat cttcatctac tgcatctgcg tgaatgtcct ggagcatctc gtccagcggg
      241 tccaggaaaa ctgagcggaa aaatgttggg ggccgcgaaa aagggatcaa taaaaattaa
      301 gcggcacttg ttttgaaaaa