Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_017145952 342 bp mRNA linear INV 09-DEC-2024 (LOC108060308), mRNA. ACCESSION XM_017145952 VERSION XM_017145952.3 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Dec 9, 2024 this sequence version replaced XM_017145952.2. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..342 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..342 /gene="LOC108060308" /note="uncharacterized LOC108060308; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 Protein" /db_xref="GeneID:108060308" CDS 8..232 /gene="LOC108060308" /codon_start=1 /product="uncharacterized protein" /protein_id="XP_017001441.2" /db_xref="GeneID:108060308" /translation="MKYTLVFLLALTLVLLMGQKCWAAPSADDLAKFGEMERTIKELT SSILAMSGATPGLNPGVRNGNNVWPEDLQA" polyA_site 342 /gene="LOC108060308" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 caaaccaatg aaatacacac ttgttttcct tctggccctg accctggtcc ttttgatggg 61 ccaaaaatgc tgggctgctc cctcggccga tgatttggcc aagtttgggg aaatggagcg 121 taccatcaag gagctaacca gttcgatcct ggccatgagt ggagctacgc cgggtcttaa 181 tcctggcgtt agaaatggaa ataatgtttg gcctgaagat ctgcaggcct aggttttgga 241 cgcatccaat tcgctcggtc tactaaatcg tgtttagcag ctctgcagtt tattattttt 301 tattttgtct tgtttttttg aaaataaaat tttaagcaca aa