Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii uncharacterized protein


LOCUS       XM_017145952             342 bp    mRNA    linear   INV 09-DEC-2024
            (LOC108060308), mRNA.
ACCESSION   XM_017145952
VERSION     XM_017145952.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017145952.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..342
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..342
                     /gene="LOC108060308"
                     /note="uncharacterized LOC108060308; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 1
                     Protein"
                     /db_xref="GeneID:108060308"
     CDS             8..232
                     /gene="LOC108060308"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_017001441.2"
                     /db_xref="GeneID:108060308"
                     /translation="MKYTLVFLLALTLVLLMGQKCWAAPSADDLAKFGEMERTIKELT
                     SSILAMSGATPGLNPGVRNGNNVWPEDLQA"
     polyA_site      342
                     /gene="LOC108060308"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 caaaccaatg aaatacacac ttgttttcct tctggccctg accctggtcc ttttgatggg
       61 ccaaaaatgc tgggctgctc cctcggccga tgatttggcc aagtttgggg aaatggagcg
      121 taccatcaag gagctaacca gttcgatcct ggccatgagt ggagctacgc cgggtcttaa
      181 tcctggcgtt agaaatggaa ataatgtttg gcctgaagat ctgcaggcct aggttttgga
      241 cgcatccaat tcgctcggtc tactaaatcg tgtttagcag ctctgcagtt tattattttt
      301 tattttgtct tgtttttttg aaaataaaat tttaagcaca aa