Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii uncharacterized protein


LOCUS       XM_017145951             566 bp    mRNA    linear   INV 09-DEC-2024
            (LOC108060307), mRNA.
ACCESSION   XM_017145951
VERSION     XM_017145951.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017145951.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..566
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..566
                     /gene="LOC108060307"
                     /note="uncharacterized LOC108060307; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 1
                     Protein"
                     /db_xref="GeneID:108060307"
     CDS             102..461
                     /gene="LOC108060307"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_017001440.2"
                     /db_xref="GeneID:108060307"
                     /translation="MDGDQIRKSSSDQDLEYSQSRRKGVHYASIAEFLASLNINDTTL
                     GSVRGVGTLSLEDYLKIVRSADKKEQGDGNSITLETKKISKKSLQEINNRQVRQSDAK
                     NLSKSKLISQYTEKIWI"
ORIGIN      
        1 aatgccttac atttccatcc ctagacaaac taaattcaac tgttaaaaaa attccaaaaa
       61 aagggcaacc aaataatttg acttacattt aaatttctca aatggacgga gatcaaatcc
      121 ggaagagcag cagcgatcag gacttggaat atagtcaaag tcgccgcaaa ggcgttcatt
      181 atgcctcgat tgccgaattc ctggcgagtc tcaatatcaa tgataccact ttgggatctg
      241 ttcggggtgt tggaaccctg agcctggagg attacctaaa gatcgtgcga agtgccgata
      301 aaaaagagca gggcgacggg aatagtatta ctctcgaaac caaaaagata agcaagaaat
      361 cgttgcagga aatcaacaac cggcaagtca ggcagtcaga tgcaaagaat ctcagcaaat
      421 ccaaactaat atctcagtac actgaaaaga tttggattta atcccaaaat tattgtaatc
      481 ttatacgtat ccataaagat tatggttaac attataaatt gtaaattgta agtcaaatgg
      541 catattttat tatgataata taaagg