Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_017145951 566 bp mRNA linear INV 09-DEC-2024 (LOC108060307), mRNA. ACCESSION XM_017145951 VERSION XM_017145951.3 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Dec 9, 2024 this sequence version replaced XM_017145951.2. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..566 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..566 /gene="LOC108060307" /note="uncharacterized LOC108060307; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 Protein" /db_xref="GeneID:108060307" CDS 102..461 /gene="LOC108060307" /codon_start=1 /product="uncharacterized protein" /protein_id="XP_017001440.2" /db_xref="GeneID:108060307" /translation="MDGDQIRKSSSDQDLEYSQSRRKGVHYASIAEFLASLNINDTTL GSVRGVGTLSLEDYLKIVRSADKKEQGDGNSITLETKKISKKSLQEINNRQVRQSDAK NLSKSKLISQYTEKIWI" ORIGIN 1 aatgccttac atttccatcc ctagacaaac taaattcaac tgttaaaaaa attccaaaaa 61 aagggcaacc aaataatttg acttacattt aaatttctca aatggacgga gatcaaatcc 121 ggaagagcag cagcgatcag gacttggaat atagtcaaag tcgccgcaaa ggcgttcatt 181 atgcctcgat tgccgaattc ctggcgagtc tcaatatcaa tgataccact ttgggatctg 241 ttcggggtgt tggaaccctg agcctggagg attacctaaa gatcgtgcga agtgccgata 301 aaaaagagca gggcgacggg aatagtatta ctctcgaaac caaaaagata agcaagaaat 361 cgttgcagga aatcaacaac cggcaagtca ggcagtcaga tgcaaagaat ctcagcaaat 421 ccaaactaat atctcagtac actgaaaaga tttggattta atcccaaaat tattgtaatc 481 ttatacgtat ccataaagat tatggttaac attataaatt gtaaattgta agtcaaatgg 541 catattttat tatgataata taaagg