Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_017145948 395 bp mRNA linear INV 09-DEC-2024 (LOC108060305), mRNA. ACCESSION XM_017145948 VERSION XM_017145948.2 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Oct 18, 2021 this sequence version replaced XM_017145948.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..395 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..395 /gene="LOC108060305" /note="uncharacterized LOC108060305; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 Protein" /db_xref="GeneID:108060305" CDS 26..208 /gene="LOC108060305" /codon_start=1 /product="uncharacterized protein" /protein_id="XP_017001437.1" /db_xref="GeneID:108060305" /translation="MRFYLLFFLALSCCLLQFSVAGVNLVRGLQTAGHHRNSTGSPPP RGAPPPPRTTTASSSG" polyA_site 395 /gene="LOC108060305" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 ccaatgccaa ccattccaca tcaagatgcg tttctatctg ctcttctttt tggccctcag 61 ctgctgtctg ctgcaattct ccgtggctgg agttaacttg gtgcgcggtc tgcagactgc 121 cggtcatcat cgcaactcca cgggttcgcc accaccgcgt ggtgctcctc cgccacctcg 181 caccaccacc gccagctctt cgggataaaa ggatggattg gatatagatc ccaactgaaa 241 tcttgaaaca ttgacgaacc tatgaaatga accctttttg tgaaccgtaa ctctatgtag 301 tccttcagct ttaaaataaa taaaaaaaac tttccagcaa aaaaagaaac gaaattaatc 361 attttttaat atacggcaaa gaggtaaaaa tatct