PREDICTED: Drosophila takahashii uncharacterized protein

LOCUS       XM_017145947             604 bp    mRNA    linear   INV 09-DEC-2024
            (LOC108060304), mRNA.
ACCESSION   XM_017145947
VERSION     XM_017145947.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017145947.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..604
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..604
                     /gene="LOC108060304"
                     /note="uncharacterized LOC108060304; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 2
                     Proteins"
                     /db_xref="GeneID:108060304"
     CDS             71..454
                     /gene="LOC108060304"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_017001436.1"
                     /db_xref="GeneID:108060304"
                     /translation="MQTSKFSQTVSNSLRLMGLGVAVGVAACGLAALRLPNASGRIGQ
                     LWKSAFGNIGTRRFYSGGFQERMTPREASQILGTSLSAPWSRIREAHRRVILANHPDR
                     NGSPYLAAKINEAKHVLLERKNRSR"
     misc_feature    <254..430
                     /gene="LOC108060304"
                     /note="DnaJ domain or J-domain. DnaJ/Hsp40 (heat shock
                     protein 40) proteins are highly conserved and play crucial
                     roles in protein translation, folding, unfolding,
                     translocation, and degradation. They act primarily by
                     stimulating the ATPase activity of Hsp70s; Region: DnaJ;
                     cl02542"
                     /db_xref="CDD:413365"
     misc_feature    order(365..373,386..388,395..400,407..412)
                     /gene="LOC108060304"
                     /note="HSP70 interaction site [polypeptide binding]; other
                     site"
                     /db_xref="CDD:99751"
ORIGIN      
        1 ttcctgtcat ttcttataaa ttcacacaca taacattttc atattgtttt ttcctcaatt
       61 cggttttaaa atgcagacta gtaaattctc gcagaccgtt agtaactcgc tgcgtttgat
      121 gggactgggc gtggcagtgg gcgtggccgc ctgcggattg gccgccctca gattgcccaa
      181 cgcctccggc cggattggtc agctgtggaa atcggccttc ggaaatatcg gcaccaggcg
      241 cttttacagc ggcggctttc aggagcggat gacgcctcgg gaggcgtcac aaattctggg
      301 cactagcctg agcgccccgt ggagtcgaat tcgggaggcc caccgccggg tgatcctggc
      361 caatcatccg gatcgcaacg gctcaccata tctggcggcc aagatcaacg aggcaaagca
      421 tgtactttta gaaagaaaga atcgatccag atagtaaacg attcgggagc agggggatat
      481 atgacagccg gtcgactgga acttcgatga aaactaaaat cgtgactaac gaaatgtgcg
      541 tagcttagta aagttaaatt taagtacttc ctgggcagta ggatattaaa ttattaagca
      601 atga