Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_017145946 562 bp mRNA linear INV 09-DEC-2024 (LOC108060303), mRNA. ACCESSION XM_017145946 VERSION XM_017145946.3 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Dec 9, 2024 this sequence version replaced XM_017145946.2. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..562 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..562 /gene="LOC108060303" /note="uncharacterized LOC108060303; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 Protein" /db_xref="GeneID:108060303" CDS 43..429 /gene="LOC108060303" /codon_start=1 /product="uncharacterized protein" /protein_id="XP_017001435.2" /db_xref="GeneID:108060303" /translation="MKITFAILGFFVALFCSPMNASSATNCTIQVIYNQSKFFCDYFK PLNVNFCTGFTTSISNQNIEAFLATQEKIFCSLPFIPFIGYICDVCNFSTIFSQNENI TIATGNSTTGSTRILGVPTLIAGGPA" polyA_site 562 /gene="LOC108060303" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 tggaggtttc ctaaatcagt ttccatccac caacaagtca agatgaagat tacctttgca 61 attctaggat ttttcgtggc tcttttctgc agcccgatga atgcttcgag tgcaacgaat 121 tgtaccatcc aagtgatata taaccaatcc aaattctttt gtgattactt caaacccctt 181 aatgtgaatt tctgcaccgg ctttactacc agtatcagca accaaaacat tgaagcattc 241 ctggcaacgc aagaaaaaat attctgttct cttccgttca ttccgttcat tggctatatc 301 tgcgatgtat gcaatttttc tacaattttt tcacaaaatg agaatattac gattgcaacc 361 ggaaactcaa ctacaggctc cacacggatt ttgggagttc ctactttgat tgctggagga 421 cccgcttaaa ccatgcgata aggaaatgta ccagccaata aaccgaacca gaatattgaa 481 tttatattat tgcaactaat tcctttttgc ttgcactttg gcatgccaag ccctaaataa 541 attccccaag cattgcaaaa ta