Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii translation initiation factor IF-2


LOCUS       XM_017145944             386 bp    mRNA    linear   INV 09-DEC-2024
            (LOC108060299), mRNA.
ACCESSION   XM_017145944
VERSION     XM_017145944.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017145944.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..386
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..386
                     /gene="LOC108060299"
                     /note="translation initiation factor IF-2; Derived by
                     automated computational analysis using gene prediction
                     method: Gnomon. Supporting evidence includes similarity
                     to: 1 Protein"
                     /db_xref="GeneID:108060299"
     CDS             63..257
                     /gene="LOC108060299"
                     /codon_start=1
                     /product="translation initiation factor IF-2"
                     /protein_id="XP_017001433.1"
                     /db_xref="GeneID:108060299"
                     /translation="MHLNLKYFIGLLVVLLCSSFAMAYPQGGPCGPPPSGTPPSGPRP
                     SGPPPGGRCGPPPSTTASSG"
     polyA_site      386
                     /gene="LOC108060299"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 cctataaaag cggccagcga aactcgaatg ggcaacagtt aacatctgga catttcgaga
       61 agatgcatct aaacctgaaa tatttcatcg gtctgctcgt ggtgctgctc tgcagctctt
      121 ttgcgatggc ctatccccag ggtggtcctt gtggtcctcc gcccagtggc actccgcctt
      181 cgggtcctcg gccatcgggt cctccacctg gcggtcgctg cggacctcct ccttcgacca
      241 cggcgtcctc cggttagcgg gtttctgatc cccactccta tccccatcat caggcttcga
      301 cgcgtcacac gggcaaatcc tttagctaag tctatttttt ttcgatagtc aattcaagaa
      361 tatatatgtg tgtgtaaact gctaaa