Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_017145944 386 bp mRNA linear INV 09-DEC-2024 (LOC108060299), mRNA. ACCESSION XM_017145944 VERSION XM_017145944.3 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Dec 9, 2024 this sequence version replaced XM_017145944.2. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..386 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..386 /gene="LOC108060299" /note="translation initiation factor IF-2; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 Protein" /db_xref="GeneID:108060299" CDS 63..257 /gene="LOC108060299" /codon_start=1 /product="translation initiation factor IF-2" /protein_id="XP_017001433.1" /db_xref="GeneID:108060299" /translation="MHLNLKYFIGLLVVLLCSSFAMAYPQGGPCGPPPSGTPPSGPRP SGPPPGGRCGPPPSTTASSG" polyA_site 386 /gene="LOC108060299" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 cctataaaag cggccagcga aactcgaatg ggcaacagtt aacatctgga catttcgaga 61 agatgcatct aaacctgaaa tatttcatcg gtctgctcgt ggtgctgctc tgcagctctt 121 ttgcgatggc ctatccccag ggtggtcctt gtggtcctcc gcccagtggc actccgcctt 181 cgggtcctcg gccatcgggt cctccacctg gcggtcgctg cggacctcct ccttcgacca 241 cggcgtcctc cggttagcgg gtttctgatc cccactccta tccccatcat caggcttcga 301 cgcgtcacac gggcaaatcc tttagctaag tctatttttt ttcgatagtc aattcaagaa 361 tatatatgtg tgtgtaaact gctaaa