Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_017145943 614 bp mRNA linear INV 09-DEC-2024 (LOC108060298), mRNA. ACCESSION XM_017145943 VERSION XM_017145943.3 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Dec 9, 2024 this sequence version replaced XM_017145943.2. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..614 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..614 /gene="LOC108060298" /note="uncharacterized LOC108060298; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 Protein" /db_xref="GeneID:108060298" CDS 66..545 /gene="LOC108060298" /codon_start=1 /product="uncharacterized protein" /protein_id="XP_017001432.1" /db_xref="GeneID:108060298" /translation="MRCRLKKCCFMITLRVGCIISSLILVFFELLAVPLRSAEPCCDS FEGVLVVVYRVLEIVHFVGCLMLFVASFLKTSVLVFFFLVTSCLHTLLFPAFLVAEVM VWNADIIDIGLSICGLLLGIYFWVVAYAFYHQCKEEVVTDLTLITTFRKKGSLVSVV" ORIGIN 1 tacgtagatt taacagtcaa aggaaaagaa aatcaaatcg aatcaaccaa agaaccaaat 61 cagtcatgag gtgccgcctg aaaaagtgct gcttcatgat taccctacga gtgggttgta 121 taatcagttc cctgattttg gtattttttg aactcctcgc agttccgctg agaagtgcag 181 agccctgctg cgattccttc gaaggcgtcc tcgtggtggt ctatagggtt ctggaaatag 241 tgcactttgt gggctgtctg atgctgttcg ttgcctcttt tttgaaaaca tccgttctgg 301 tatttttctt tctcgtcacg agttgtctac acactttgct gtttcccgct ttcttggtgg 361 ccgaagttat ggtttggaat gcagacatca ttgacattgg tctctccatc tgtggtcttc 421 ttttaggcat ttacttctgg gttgtggcct acgcttttta tcaccagtgc aaggaggagg 481 tggtcaccga tttgactctc ataaccacct ttcgaaaaaa gggatcattg gtatcagtgg 541 tttagcttaa taataaaatg acgtgtataa aataaatcta ttttgaataa aaatctaaga 601 agtcccccag aaaa