Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii uncharacterized protein


LOCUS       XM_017145943             614 bp    mRNA    linear   INV 09-DEC-2024
            (LOC108060298), mRNA.
ACCESSION   XM_017145943
VERSION     XM_017145943.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017145943.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..614
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..614
                     /gene="LOC108060298"
                     /note="uncharacterized LOC108060298; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 1
                     Protein"
                     /db_xref="GeneID:108060298"
     CDS             66..545
                     /gene="LOC108060298"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_017001432.1"
                     /db_xref="GeneID:108060298"
                     /translation="MRCRLKKCCFMITLRVGCIISSLILVFFELLAVPLRSAEPCCDS
                     FEGVLVVVYRVLEIVHFVGCLMLFVASFLKTSVLVFFFLVTSCLHTLLFPAFLVAEVM
                     VWNADIIDIGLSICGLLLGIYFWVVAYAFYHQCKEEVVTDLTLITTFRKKGSLVSVV"
ORIGIN      
        1 tacgtagatt taacagtcaa aggaaaagaa aatcaaatcg aatcaaccaa agaaccaaat
       61 cagtcatgag gtgccgcctg aaaaagtgct gcttcatgat taccctacga gtgggttgta
      121 taatcagttc cctgattttg gtattttttg aactcctcgc agttccgctg agaagtgcag
      181 agccctgctg cgattccttc gaaggcgtcc tcgtggtggt ctatagggtt ctggaaatag
      241 tgcactttgt gggctgtctg atgctgttcg ttgcctcttt tttgaaaaca tccgttctgg
      301 tatttttctt tctcgtcacg agttgtctac acactttgct gtttcccgct ttcttggtgg
      361 ccgaagttat ggtttggaat gcagacatca ttgacattgg tctctccatc tgtggtcttc
      421 ttttaggcat ttacttctgg gttgtggcct acgcttttta tcaccagtgc aaggaggagg
      481 tggtcaccga tttgactctc ataaccacct ttcgaaaaaa gggatcattg gtatcagtgg
      541 tttagcttaa taataaaatg acgtgtataa aataaatcta ttttgaataa aaatctaaga
      601 agtcccccag aaaa