Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_017145941 836 bp mRNA linear INV 09-DEC-2024 (LOC108060297), mRNA. ACCESSION XM_017145941 VERSION XM_017145941.3 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Dec 9, 2024 this sequence version replaced XM_017145941.2. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..836 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..836 /gene="LOC108060297" /note="uncharacterized LOC108060297; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 Protein" /db_xref="GeneID:108060297" CDS 94..366 /gene="LOC108060297" /codon_start=1 /product="uncharacterized protein" /protein_id="XP_017001430.2" /db_xref="GeneID:108060297" /translation="MVFLLKLLALLAVGAISVQMTLALEFMDEGSFGNDEAHHLDEES SAEVPGILTGYTRDTIAHFNPRKADAGFRQLWERVPLQKGDVIKRR" ORIGIN 1 gtttcagttc gcattcgccg ctcaacgtaa aatgttgtga ggttctgatt ttgacccccg 61 gcaaacaaaa atatagcgat atttccagcg attatggttt ttctcctcaa actattggcc 121 cttttggcag tgggcgccat ttctgtacaa atgaccctgg ccctggagtt catggacgag 181 ggatcttttg gaaacgatga ggcccaccat ttggatgagg agtcttcggc tgaggtgcct 241 ggaattttaa ctggttatac cagggataca attgctcact ttaatccccg aaaagcagat 301 gcaggatttc gacaattatg ggaacgtgtt ccgctgcaaa aaggggatgt cattaagcgg 361 agatagggga atttacatac tctcattaat ttaaaggaaa acgaaataac caatggaatt 421 taattgcata taaagtgaat ttgtatagtt aaaatatttt ttttttttaa atatataata 481 caaaatatta tatatttaaa tatataatat ttaaatatat aatacaaaat attatatatt 541 taaatattaa ttagataaat actgaaatat tgtttgggga gcaggaaaat gtaaactatt 601 gcaaagtact tctgtacagc taaagaaaac ccataagaaa ccataaatgc ggcaaaagaa 661 caattccctt cgaggttttt tgggtcaaac ctttttgtct tcggcccagg ggctaaacca 721 tccccccaat aacccaccca actttgtggt tttctcccga cgccaccctc tcccaaaaac 781 caaagcaacc ttcagccttc aagtagttct tagaaagtaa taaaaaaaaa gaaacc