Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii uncharacterized protein


LOCUS       XM_017145941             836 bp    mRNA    linear   INV 09-DEC-2024
            (LOC108060297), mRNA.
ACCESSION   XM_017145941
VERSION     XM_017145941.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017145941.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..836
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..836
                     /gene="LOC108060297"
                     /note="uncharacterized LOC108060297; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 1
                     Protein"
                     /db_xref="GeneID:108060297"
     CDS             94..366
                     /gene="LOC108060297"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_017001430.2"
                     /db_xref="GeneID:108060297"
                     /translation="MVFLLKLLALLAVGAISVQMTLALEFMDEGSFGNDEAHHLDEES
                     SAEVPGILTGYTRDTIAHFNPRKADAGFRQLWERVPLQKGDVIKRR"
ORIGIN      
        1 gtttcagttc gcattcgccg ctcaacgtaa aatgttgtga ggttctgatt ttgacccccg
       61 gcaaacaaaa atatagcgat atttccagcg attatggttt ttctcctcaa actattggcc
      121 cttttggcag tgggcgccat ttctgtacaa atgaccctgg ccctggagtt catggacgag
      181 ggatcttttg gaaacgatga ggcccaccat ttggatgagg agtcttcggc tgaggtgcct
      241 ggaattttaa ctggttatac cagggataca attgctcact ttaatccccg aaaagcagat
      301 gcaggatttc gacaattatg ggaacgtgtt ccgctgcaaa aaggggatgt cattaagcgg
      361 agatagggga atttacatac tctcattaat ttaaaggaaa acgaaataac caatggaatt
      421 taattgcata taaagtgaat ttgtatagtt aaaatatttt ttttttttaa atatataata
      481 caaaatatta tatatttaaa tatataatat ttaaatatat aatacaaaat attatatatt
      541 taaatattaa ttagataaat actgaaatat tgtttgggga gcaggaaaat gtaaactatt
      601 gcaaagtact tctgtacagc taaagaaaac ccataagaaa ccataaatgc ggcaaaagaa
      661 caattccctt cgaggttttt tgggtcaaac ctttttgtct tcggcccagg ggctaaacca
      721 tccccccaat aacccaccca actttgtggt tttctcccga cgccaccctc tcccaaaaac
      781 caaagcaacc ttcagccttc aagtagttct tagaaagtaa taaaaaaaaa gaaacc