Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii Chemosensory protein A 7a


LOCUS       XM_017145940             689 bp    mRNA    linear   INV 09-DEC-2024
            (CheA7a), mRNA.
ACCESSION   XM_017145940
VERSION     XM_017145940.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017145940.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..689
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..689
                     /gene="CheA7a"
                     /note="Chemosensory protein A 7a; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 1
                     Protein"
                     /db_xref="GeneID:108060295"
     CDS             9..551
                     /gene="CheA7a"
                     /codon_start=1
                     /product="uncharacterized protein CheA7a"
                     /protein_id="XP_017001429.2"
                     /db_xref="GeneID:108060295"
                     /translation="MAVRHLFTLFLPIILVLMCRGEKPYNVELNTFEMDQTIENQDNW
                     VVWGTLRMKKVSRNKFVVSGDFEFKLNMADQQKIALMVFTYDQNTKKRGAMVLNVNKP
                     FCQFIKEDEDTYPQILKVSNLPEQGKCPFPKGKYQIDNYELETNFLPDNAPKGDYLLQ
                     LTLMDREIPVAGLVATVTLT"
     misc_feature    291..548
                     /gene="CheA7a"
                     /note="Repeats found in several Drosophila proteins;
                     Region: DM8; smart00697"
                     /db_xref="CDD:214778"
ORIGIN      
        1 ttggcaagat ggcagtgcgc catttattta ctctttttct tccaatcatt ttggttctaa
       61 tgtgtcgtgg ggaaaagccg tacaatgttg agttgaatac ctttgagatg gaccaaacca
      121 tcgaaaatca ggataactgg gtggtctggg gaacgctgag gatgaagaag gtctcgcgaa
      181 ataaatttgt ggtgtctggg gactttgaat ttaaactcaa tatggccgat cagcaaaaga
      241 ttgctctaat ggtttttacc tacgatcaaa acaccaaaaa gcgcggggcg atggtcttga
      301 atgtgaacaa gccgttctgt caattcatca aggaggacga ggacacgtat ccccagattc
      361 tgaaggtctc aaacttgccg gagcagggaa agtgcccctt tccgaaggga aaataccaga
      421 ttgacaacta cgagctggag accaacttcc tgcccgataa tgcccccaag ggggactatc
      481 tgctgcagtt gaccttgatg gatcgagaga ttccagtggc tggacttgtg gccaccgtga
      541 ccctgactta ggagtccttt tctttttttt ttgtcttact agtttattat attttccggt
      601 tggatccatt tgacacgata cgcgttattc ttgatatttc atttatatta taatttacct
      661 taacttgaac atcaatataa cgactactg