Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_017145940 689 bp mRNA linear INV 09-DEC-2024 (CheA7a), mRNA. ACCESSION XM_017145940 VERSION XM_017145940.3 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Dec 9, 2024 this sequence version replaced XM_017145940.2. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..689 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..689 /gene="CheA7a" /note="Chemosensory protein A 7a; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 Protein" /db_xref="GeneID:108060295" CDS 9..551 /gene="CheA7a" /codon_start=1 /product="uncharacterized protein CheA7a" /protein_id="XP_017001429.2" /db_xref="GeneID:108060295" /translation="MAVRHLFTLFLPIILVLMCRGEKPYNVELNTFEMDQTIENQDNW VVWGTLRMKKVSRNKFVVSGDFEFKLNMADQQKIALMVFTYDQNTKKRGAMVLNVNKP FCQFIKEDEDTYPQILKVSNLPEQGKCPFPKGKYQIDNYELETNFLPDNAPKGDYLLQ LTLMDREIPVAGLVATVTLT" misc_feature 291..548 /gene="CheA7a" /note="Repeats found in several Drosophila proteins; Region: DM8; smart00697" /db_xref="CDD:214778" ORIGIN 1 ttggcaagat ggcagtgcgc catttattta ctctttttct tccaatcatt ttggttctaa 61 tgtgtcgtgg ggaaaagccg tacaatgttg agttgaatac ctttgagatg gaccaaacca 121 tcgaaaatca ggataactgg gtggtctggg gaacgctgag gatgaagaag gtctcgcgaa 181 ataaatttgt ggtgtctggg gactttgaat ttaaactcaa tatggccgat cagcaaaaga 241 ttgctctaat ggtttttacc tacgatcaaa acaccaaaaa gcgcggggcg atggtcttga 301 atgtgaacaa gccgttctgt caattcatca aggaggacga ggacacgtat ccccagattc 361 tgaaggtctc aaacttgccg gagcagggaa agtgcccctt tccgaaggga aaataccaga 421 ttgacaacta cgagctggag accaacttcc tgcccgataa tgcccccaag ggggactatc 481 tgctgcagtt gaccttgatg gatcgagaga ttccagtggc tggacttgtg gccaccgtga 541 ccctgactta ggagtccttt tctttttttt ttgtcttact agtttattat attttccggt 601 tggatccatt tgacacgata cgcgttattc ttgatatttc atttatatta taatttacct 661 taacttgaac atcaatataa cgactactg