Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii venom allergen-1 (LOC108060286),


LOCUS       XM_017145927             899 bp    mRNA    linear   INV 09-DEC-2024
            mRNA.
ACCESSION   XM_017145927
VERSION     XM_017145927.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017145927.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..899
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..899
                     /gene="LOC108060286"
                     /note="venom allergen-1; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 2
                     Proteins"
                     /db_xref="GeneID:108060286"
     CDS             43..810
                     /gene="LOC108060286"
                     /codon_start=1
                     /product="venom allergen-1"
                     /protein_id="XP_017001416.2"
                     /db_xref="GeneID:108060286"
                     /translation="MSGHTVLILFISLVIYCLAEEYCRKDLCQGMPHIACENPTGAFG
                     SACPPSVTVRELDQDLKNILVRDHNLERQKWASGKGKFPRSACRMETVKWDDDLANLA
                     LLNAKTCTTEHDACHNIGKYMYSGQNIYLVTFQQCPRRRPQIEITTSELLRNATKSWA
                     REEKNFESDHDLQSFPLPQIDKEPIGHLTVVINEKSNAVGCGIVTYMMPNNTREFILT
                     CNYAYTNYLHGTVYSQCEKAGSQCPNGLSSQYPPLCA"
     misc_feature    223..708
                     /gene="LOC108060286"
                     /note="Eukaryotic CAP (cysteine-rich secretory proteins,
                     antigen 5, and pathogenesis-related 1 proteins) domain
                     proteins; Region: CAP_euk; cd05380"
                     /db_xref="CDD:349399"
     polyA_site      899
                     /gene="LOC108060286"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 aaagcggaat gcatttgttg aaggttccga aaaagttgca aaatgtcggg ccacacggtt
       61 ttaatattat tcatatccct agtgatctat tgtttggcgg aggaatactg caggaaggat
      121 ctctgccaag gaatgcccca tatagcgtgt gaaaatccca ccggagcctt cggtagcgcg
      181 tgtcccccaa gtgtcaccgt ccgcgaactc gatcaggatc ttaagaatat tcttgtgagg
      241 gaccacaact tggagagaca gaagtgggcc agtggcaagg ggaagtttcc gaggagcgcc
      301 tgcagaatgg agacagtgaa atgggatgac gacttggcca atttggcatt actaaatgca
      361 aaaacctgca caacggaaca tgatgcttgt cataatatcg gaaagtatat gtattccggc
      421 cagaatatct atttggtgac ctttcagcaa tgcccaagaa gaagaccgca aatagaaata
      481 acaactagtg aacttttgcg gaatgcaact aaatcttggg caagagaaga aaagaacttt
      541 gaatccgatc atgacttaca gagtttcccc ctcccccaaa tcgataaaga accgattggt
      601 cacttgaccg ttgtgatcaa tgagaaaagt aacgccgtgg gctgtggcat agttacctat
      661 atgatgccga ataacactcg ggaatttatt ctgacctgta actacgccta tactaattat
      721 cttcacggta ctgtctacag ccaatgcgaa aaggcaggca gtcagtgtcc caacggactg
      781 agctcgcagt atccaccatt atgtgcctaa ataaaatatg tttcaagaaa aaatataatt
      841 tacattctga gctgttttcg aaaaattcat taaagatgta caaaatctgg aaccctaaa