Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_017145927 899 bp mRNA linear INV 09-DEC-2024 mRNA. ACCESSION XM_017145927 VERSION XM_017145927.3 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Dec 9, 2024 this sequence version replaced XM_017145927.2. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..899 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..899 /gene="LOC108060286" /note="venom allergen-1; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 2 Proteins" /db_xref="GeneID:108060286" CDS 43..810 /gene="LOC108060286" /codon_start=1 /product="venom allergen-1" /protein_id="XP_017001416.2" /db_xref="GeneID:108060286" /translation="MSGHTVLILFISLVIYCLAEEYCRKDLCQGMPHIACENPTGAFG SACPPSVTVRELDQDLKNILVRDHNLERQKWASGKGKFPRSACRMETVKWDDDLANLA LLNAKTCTTEHDACHNIGKYMYSGQNIYLVTFQQCPRRRPQIEITTSELLRNATKSWA REEKNFESDHDLQSFPLPQIDKEPIGHLTVVINEKSNAVGCGIVTYMMPNNTREFILT CNYAYTNYLHGTVYSQCEKAGSQCPNGLSSQYPPLCA" misc_feature 223..708 /gene="LOC108060286" /note="Eukaryotic CAP (cysteine-rich secretory proteins, antigen 5, and pathogenesis-related 1 proteins) domain proteins; Region: CAP_euk; cd05380" /db_xref="CDD:349399" polyA_site 899 /gene="LOC108060286" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 aaagcggaat gcatttgttg aaggttccga aaaagttgca aaatgtcggg ccacacggtt 61 ttaatattat tcatatccct agtgatctat tgtttggcgg aggaatactg caggaaggat 121 ctctgccaag gaatgcccca tatagcgtgt gaaaatccca ccggagcctt cggtagcgcg 181 tgtcccccaa gtgtcaccgt ccgcgaactc gatcaggatc ttaagaatat tcttgtgagg 241 gaccacaact tggagagaca gaagtgggcc agtggcaagg ggaagtttcc gaggagcgcc 301 tgcagaatgg agacagtgaa atgggatgac gacttggcca atttggcatt actaaatgca 361 aaaacctgca caacggaaca tgatgcttgt cataatatcg gaaagtatat gtattccggc 421 cagaatatct atttggtgac ctttcagcaa tgcccaagaa gaagaccgca aatagaaata 481 acaactagtg aacttttgcg gaatgcaact aaatcttggg caagagaaga aaagaacttt 541 gaatccgatc atgacttaca gagtttcccc ctcccccaaa tcgataaaga accgattggt 601 cacttgaccg ttgtgatcaa tgagaaaagt aacgccgtgg gctgtggcat agttacctat 661 atgatgccga ataacactcg ggaatttatt ctgacctgta actacgccta tactaattat 721 cttcacggta ctgtctacag ccaatgcgaa aaggcaggca gtcagtgtcc caacggactg 781 agctcgcagt atccaccatt atgtgcctaa ataaaatatg tttcaagaaa aaatataatt 841 tacattctga gctgttttcg aaaaattcat taaagatgta caaaatctgg aaccctaaa