PREDICTED: Drosophila takahashii hemocytin (LOC108060280), mRNA.

LOCUS       XM_017145920             231 bp    mRNA    linear   INV 09-DEC-2024
ACCESSION   XM_017145920
VERSION     XM_017145920.2
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq; includes ab initio.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Oct 18, 2021 this sequence version replaced XM_017145920.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
            
            ##RefSeq-Attributes-START##
            ab initio :: 6% of CDS bases
            ##RefSeq-Attributes-END##
FEATURES             Location/Qualifiers
     source          1..231
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..231
                     /gene="LOC108060280"
                     /note="hemocytin; Derived by automated computational
                     analysis using gene prediction method: Gnomon. Supporting
                     evidence includes similarity to: 1 Protein"
                     /db_xref="GeneID:108060280"
     CDS             7..231
                     /gene="LOC108060280"
                     /codon_start=1
                     /product="hemocytin"
                     /protein_id="XP_017001409.2"
                     /db_xref="GeneID:108060280"
                     /translation="MRQCTSIYAIIFGLLIALQCLTLGDTAPIGEHPDHAGCIRITII
                     KRPLTTTTTTTTTTTTTTTTTRAPTTVATG"
ORIGIN      
        1 atcacgatga ggcagtgcac gtccatatac gctataatat tcggcctgct gattgccctg
       61 cagtgcctga cccttggcga cacggcgccc atcggcgaac atccggatca cgccggctgc
      121 atacggataa cgatcatcaa acgacctttg accaccacaa cgacgacaac cacgaccact
      181 acgacgacca caacaacgac cagagcccca acaacagtgg caactggtta g