Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_017144647 831 bp mRNA linear INV 09-DEC-2024 membrane translocase subunit Tim29 (LOC108059401), mRNA. ACCESSION XM_017144647 VERSION XM_017144647.3 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Dec 9, 2024 this sequence version replaced XM_017144647.2. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..831 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..831 /gene="LOC108059401" /note="mitochondrial import inner membrane translocase subunit Tim29; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 Protein" /db_xref="GeneID:108059401" CDS 177..752 /gene="LOC108059401" /codon_start=1 /product="mitochondrial import inner membrane translocase subunit Tim29" /protein_id="XP_017000136.2" /db_xref="GeneID:108059401" /translation="MQFLRVGGRMAALRQRLTDRIQLPERFKGTLVEKWVKYWNGLVR DYSEVAVGVVRESYTKPKKALLYGTGMLFLYHAGLNNPDEEAFMTLLRGATNRMITVP PELQNPVSADYLLTLERAINQKKLRLLSLGICTVLWVDIYDEDDCTYPAICEYTTVGL LNFHERIIDVGFWNQYWRLKWKMRNYDVNYL" misc_feature 258..746 /gene="LOC108059401" /note="Translocase of the Inner Mitochondrial membrane 29; Region: Tim29; pfam10171" /db_xref="CDD:462977" polyA_site 831 /gene="LOC108059401" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 ggttttgaac taggaggaat caaattccct ccgttattcc ctcgataccg atatatcgtc 61 atcggcgcac ggtcacattg gtaaatcagc tgttccgttt gatttgataa cactgggact 121 tggattccaa ttccacctgg ttttctccaa attgatcact gaaatcccgc ctggagatgc 181 agttcctccg cgtgggtggc cgcatggcgg ccctgcgcca gcgattgacc gaccgcatcc 241 agctgccgga gcgcttcaag ggcacgctgg tggagaagtg ggtgaagtac tggaacggcc 301 tggtgcgcga ctactcggag gtggcggtgg gcgtggtgcg ggagtcgtac acgaagccca 361 agaaggcgct gctctacggc accggcatgc tcttcctcta ccacgccggc ctcaataatc 421 ccgacgagga ggccttcatg accctgctgc gcggagccac caatcggatg atcacggtgc 481 cgccggaact gcagaatccc gtgtccgccg actacctgct caccctggag agggccatca 541 accagaagaa gctgcgcctc ctctcgctgg gcatctgcac ggtgctctgg gtggacatct 601 acgacgagga cgactgcacc tatccggcca tctgcgagta cacgacggtg ggtctgctca 661 acttccacga gcggatcatc gacgtgggct tctggaatca gtactggcgt ctcaagtgga 721 agatgcgcaa ctacgatgtc aactacctgt gatcgccgcc ctttctccct attaacttgt 781 tgaaatccct cgaggaaata ccaatatatg tatgttttta gtacagaaaa a