Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii mitochondrial import inner


LOCUS       XM_017144647             831 bp    mRNA    linear   INV 09-DEC-2024
            membrane translocase subunit Tim29 (LOC108059401), mRNA.
ACCESSION   XM_017144647
VERSION     XM_017144647.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017144647.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..831
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..831
                     /gene="LOC108059401"
                     /note="mitochondrial import inner membrane translocase
                     subunit Tim29; Derived by automated computational analysis
                     using gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 1 Protein"
                     /db_xref="GeneID:108059401"
     CDS             177..752
                     /gene="LOC108059401"
                     /codon_start=1
                     /product="mitochondrial import inner membrane translocase
                     subunit Tim29"
                     /protein_id="XP_017000136.2"
                     /db_xref="GeneID:108059401"
                     /translation="MQFLRVGGRMAALRQRLTDRIQLPERFKGTLVEKWVKYWNGLVR
                     DYSEVAVGVVRESYTKPKKALLYGTGMLFLYHAGLNNPDEEAFMTLLRGATNRMITVP
                     PELQNPVSADYLLTLERAINQKKLRLLSLGICTVLWVDIYDEDDCTYPAICEYTTVGL
                     LNFHERIIDVGFWNQYWRLKWKMRNYDVNYL"
     misc_feature    258..746
                     /gene="LOC108059401"
                     /note="Translocase of the Inner Mitochondrial membrane 29;
                     Region: Tim29; pfam10171"
                     /db_xref="CDD:462977"
     polyA_site      831
                     /gene="LOC108059401"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 ggttttgaac taggaggaat caaattccct ccgttattcc ctcgataccg atatatcgtc
       61 atcggcgcac ggtcacattg gtaaatcagc tgttccgttt gatttgataa cactgggact
      121 tggattccaa ttccacctgg ttttctccaa attgatcact gaaatcccgc ctggagatgc
      181 agttcctccg cgtgggtggc cgcatggcgg ccctgcgcca gcgattgacc gaccgcatcc
      241 agctgccgga gcgcttcaag ggcacgctgg tggagaagtg ggtgaagtac tggaacggcc
      301 tggtgcgcga ctactcggag gtggcggtgg gcgtggtgcg ggagtcgtac acgaagccca
      361 agaaggcgct gctctacggc accggcatgc tcttcctcta ccacgccggc ctcaataatc
      421 ccgacgagga ggccttcatg accctgctgc gcggagccac caatcggatg atcacggtgc
      481 cgccggaact gcagaatccc gtgtccgccg actacctgct caccctggag agggccatca
      541 accagaagaa gctgcgcctc ctctcgctgg gcatctgcac ggtgctctgg gtggacatct
      601 acgacgagga cgactgcacc tatccggcca tctgcgagta cacgacggtg ggtctgctca
      661 acttccacga gcggatcatc gacgtgggct tctggaatca gtactggcgt ctcaagtgga
      721 agatgcgcaa ctacgatgtc aactacctgt gatcgccgcc ctttctccct attaacttgt
      781 tgaaatccct cgaggaaata ccaatatatg tatgttttta gtacagaaaa a