Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii new glue 4 (ng4), mRNA.


LOCUS       XM_017144636             174 bp    mRNA    linear   INV 09-DEC-2024
ACCESSION   XM_017144636
VERSION     XM_017144636.2
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Oct 18, 2021 this sequence version replaced XM_017144636.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..174
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..174
                     /gene="ng4"
                     /note="new glue 4; Derived by automated computational
                     analysis using gene prediction method: Gnomon. Supporting
                     evidence includes similarity to: 1 Protein"
                     /db_xref="GeneID:108059394"
     CDS             1..174
                     /gene="ng4"
                     /codon_start=1
                     /product="protein new-glue 4"
                     /protein_id="XP_017000125.2"
                     /db_xref="GeneID:108059394"
                     /translation="MEWKLLLIVLPWLLIGKVFYKVEDFTEPDVAYQSLDYHPEDYID
                     SFTDYQKHDYFQY"
ORIGIN      
        1 atggaatgga aactgctgct gatagtcctg ccctggcttc ttatcggcaa ggtcttctac
       61 aaggtcgagg acttcacgga gccggatgtc gcctaccaaa gcctggacta ccatcccgag
      121 gactacatcg actccttcac cgattaccag aagcacgact actttcagta ctaa