Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii uncharacterized protein


LOCUS       XM_017144622             824 bp    mRNA    linear   INV 09-DEC-2024
            (LOC108059388), mRNA.
ACCESSION   XM_017144622
VERSION     XM_017144622.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017144622.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..824
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..824
                     /gene="LOC108059388"
                     /note="uncharacterized LOC108059388; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 2
                     Proteins"
                     /db_xref="GeneID:108059388"
     CDS             135..743
                     /gene="LOC108059388"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_017000111.2"
                     /db_xref="GeneID:108059388"
                     /translation="MQNSAQGKKASGEDACSSAACKVAAVVSKTKRKSHQFVTAPCVM
                     PKPLVVDGNTAIFQVGGEQAKMGDIPALSQLSGGSGGQPIYRIKPGTHAHVVNYIVVD
                     EGCDSNLMKKANSGDPEAMRQLLGLQRGTAVSKLQKLIAARRGNPPSNLVIRPSVPTP
                     GGPGGPGGASVGSGHVSTPQMHPDLSIASVKGGVPFVRQSPR"
ORIGIN      
        1 atcccacagt gtcatatata tttgtccctt tctaagcttg taacgcatgc ccacgtgact
       61 tactctaaca atttcgtaga aaaagccaga agacggcgac gctgattttg ccaaagaacc
      121 cgttggccca caaaatgcag aactccgccc aagggaaaaa agcttctggc gaggatgcct
      181 gcagctcagc cgcatgcaaa gtggctgctg tggtgagcaa gaccaagcgg aagagccacc
      241 agttcgtcac ggcgccgtgc gtaatgccca agccactggt cgtggatggg aacaccgcaa
      301 tcttccaggt gggcggcgag caggcgaaga tgggcgacat tccggccctt tcgcagctca
      361 gcggaggctc tggcggccag cccatctacc ggatcaagcc gggaacgcat gcgcatgtcg
      421 tcaactacat agtcgtcgac gagggatgcg actccaatct gatgaagaag gccaactccg
      481 gtgacccgga agccatgcgt caactgttgg ggcttcagcg cgggactgcc gtgagcaagc
      541 tgcagaagct catcgccgct cgccggggca atccacccag taacctcgtg atccgtccct
      601 cggtcccaac tcctggaggc ccaggaggcc ctggaggcgc ttccgtgggc agtggacatg
      661 tatccacgcc ccagatgcat ccggacctct ccattgccag cgtgaaggga ggcgttccat
      721 tcgtccgcca gtctccgagg tgaatccttc tgcgaggcac ggaacccata actgagtttg
      781 aaaactagtg aagaacactc gtttttaata aaatattgat tggt