Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_017144613 1182 bp mRNA linear INV 09-DEC-2024 (LOC108059381), mRNA. ACCESSION XM_017144613 VERSION XM_017144613.3 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Dec 9, 2024 this sequence version replaced XM_017144613.2. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..1182 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..1182 /gene="LOC108059381" /note="uncharacterized LOC108059381; Derived by automated computational analysis using gene prediction method: Gnomon." /db_xref="GeneID:108059381" CDS 71..1045 /gene="LOC108059381" /codon_start=1 /product="uncharacterized protein" /protein_id="XP_017000102.2" /db_xref="GeneID:108059381" /translation="MDPFKVPKKMNRNVLKAVSTLQSSRTDFVRLDDITQQVRIQTKK CLPVENLEQVVKESLGNLTKLGILRRRGSEKYGLSCMVFGRVGRAPPGPTTNTTDAAK PRAPLRRARQSARGKRSPGHLDPSQPDTNMLIETPIPGKEMPKPRKRIQKKTKVATPH QGLDQPERVESMELDVPAEVQNEITDPQPLFGTPGWTYPRVFQNLPTLVRDDKEDKMD ANEGEGKEGSMSCLFPVRSNFGSAFGSECDVGNPSPVLEEGQWPIVRESPIQGTQEAQ NALFLCPSSSSLEDIYRNDISEDAEGEVEISRAKIDLTNAASEYDFYK" polyA_site 1182 /gene="LOC108059381" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 cattcagtcg aatctctcac ttcccactag cagcacgcac cccaaatcaa cacttcgtat 61 cggttgagtc atggacccct ttaaagtgcc caaaaagatg aaccgcaatg ttctgaaggc 121 ggtcagcacc ctccaatcgt cgcgcaccga cttcgtgcga cttgatgata taacgcagca 181 ggtgaggatc cagactaaga agtgccttcc agtggagaac ctagaacagg tggtgaagga 241 gtcgctgggc aacctaacga agctggggat cctcaggcgg agggggtcgg agaagtacgg 301 gctcagctgc atggtctttg ggcgcgtggg gagggctccg cctggtccga ccacgaatac 361 gactgatgcg gctaaacctc gtgcaccatt gcgccgtgct aggcagagtg ctcgcggaaa 421 gcgaagtccc ggacacctgg atccgagtca gccggacacc aatatgttga ttgagactcc 481 gattcctgga aaggagatgc ctaagccgcg taagcgcatt caaaagaaga cgaaagtcgc 541 cactccgcat caaggtctcg accagcccga aagggttgaa agtatggaac tggatgtgcc 601 ggcggaagtt cagaatgaga tcaccgatcc ccagccactt ttcggcactc caggatggac 661 ctatccgcga gtttttcaga acttgccaac acttgttagg gatgataaag aggacaaaat 721 ggacgcaaat gagggtgaag gaaaggaagg ttcaatgagt tgcttgtttc ctgttcgctc 781 gaatttcggg tctgcctttg gaagcgagtg cgatgtagga aatccttctc cagtcctgga 841 agaaggtcaa tggccaattg ttcgagaatc tccaatacaa ggcactcaag aggcccaaaa 901 cgcactcttc ctgtgccctt cctcttcgag tttggaagac atataccgaa atgatatatc 961 tgaggatgca gaaggagaag tcgaaatttc ccgtgcaaag atcgatctta caaatgctgc 1021 gtctgaatat gatttctata agtaacgatg tagtgatccg tttcgcttca gtaatagttc 1081 accgatttat tgattaaact gtaaagaaat aaactatata aaaattcaaa agcaagagaa 1141 taaatattaa aatgcttttg ctcgtaatta aattaaattt ta