Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii uncharacterized protein


LOCUS       XM_017144613            1182 bp    mRNA    linear   INV 09-DEC-2024
            (LOC108059381), mRNA.
ACCESSION   XM_017144613
VERSION     XM_017144613.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017144613.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1182
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..1182
                     /gene="LOC108059381"
                     /note="uncharacterized LOC108059381; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon."
                     /db_xref="GeneID:108059381"
     CDS             71..1045
                     /gene="LOC108059381"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_017000102.2"
                     /db_xref="GeneID:108059381"
                     /translation="MDPFKVPKKMNRNVLKAVSTLQSSRTDFVRLDDITQQVRIQTKK
                     CLPVENLEQVVKESLGNLTKLGILRRRGSEKYGLSCMVFGRVGRAPPGPTTNTTDAAK
                     PRAPLRRARQSARGKRSPGHLDPSQPDTNMLIETPIPGKEMPKPRKRIQKKTKVATPH
                     QGLDQPERVESMELDVPAEVQNEITDPQPLFGTPGWTYPRVFQNLPTLVRDDKEDKMD
                     ANEGEGKEGSMSCLFPVRSNFGSAFGSECDVGNPSPVLEEGQWPIVRESPIQGTQEAQ
                     NALFLCPSSSSLEDIYRNDISEDAEGEVEISRAKIDLTNAASEYDFYK"
     polyA_site      1182
                     /gene="LOC108059381"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 cattcagtcg aatctctcac ttcccactag cagcacgcac cccaaatcaa cacttcgtat
       61 cggttgagtc atggacccct ttaaagtgcc caaaaagatg aaccgcaatg ttctgaaggc
      121 ggtcagcacc ctccaatcgt cgcgcaccga cttcgtgcga cttgatgata taacgcagca
      181 ggtgaggatc cagactaaga agtgccttcc agtggagaac ctagaacagg tggtgaagga
      241 gtcgctgggc aacctaacga agctggggat cctcaggcgg agggggtcgg agaagtacgg
      301 gctcagctgc atggtctttg ggcgcgtggg gagggctccg cctggtccga ccacgaatac
      361 gactgatgcg gctaaacctc gtgcaccatt gcgccgtgct aggcagagtg ctcgcggaaa
      421 gcgaagtccc ggacacctgg atccgagtca gccggacacc aatatgttga ttgagactcc
      481 gattcctgga aaggagatgc ctaagccgcg taagcgcatt caaaagaaga cgaaagtcgc
      541 cactccgcat caaggtctcg accagcccga aagggttgaa agtatggaac tggatgtgcc
      601 ggcggaagtt cagaatgaga tcaccgatcc ccagccactt ttcggcactc caggatggac
      661 ctatccgcga gtttttcaga acttgccaac acttgttagg gatgataaag aggacaaaat
      721 ggacgcaaat gagggtgaag gaaaggaagg ttcaatgagt tgcttgtttc ctgttcgctc
      781 gaatttcggg tctgcctttg gaagcgagtg cgatgtagga aatccttctc cagtcctgga
      841 agaaggtcaa tggccaattg ttcgagaatc tccaatacaa ggcactcaag aggcccaaaa
      901 cgcactcttc ctgtgccctt cctcttcgag tttggaagac atataccgaa atgatatatc
      961 tgaggatgca gaaggagaag tcgaaatttc ccgtgcaaag atcgatctta caaatgctgc
     1021 gtctgaatat gatttctata agtaacgatg tagtgatccg tttcgcttca gtaatagttc
     1081 accgatttat tgattaaact gtaaagaaat aaactatata aaaattcaaa agcaagagaa
     1141 taaatattaa aatgcttttg ctcgtaatta aattaaattt ta