Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii protein new-glue 1-like


LOCUS       XM_017144604             360 bp    mRNA    linear   INV 09-DEC-2024
            (LOC108059373), mRNA.
ACCESSION   XM_017144604
VERSION     XM_017144604.2
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq; includes ab initio.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Oct 18, 2021 this sequence version replaced XM_017144604.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
            
            ##RefSeq-Attributes-START##
            ab initio :: 10% of CDS bases
            ##RefSeq-Attributes-END##
FEATURES             Location/Qualifiers
     source          1..360
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..360
                     /gene="LOC108059373"
                     /note="protein new-glue 1-like; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 2
                     Proteins"
                     /db_xref="GeneID:108059373"
     CDS             1..360
                     /gene="LOC108059373"
                     /codon_start=1
                     /product="protein new-glue 1-like"
                     /protein_id="XP_017000093.2"
                     /db_xref="GeneID:108059373"
                     /translation="MKITPLLVLLATFLGCAMIRQSEGASSTTTTSASATTTTAASAT
                     TSASAATTTTAASDSTTTTTESSSLVASGTKKQVIRHEKRKRHRPRKIRRTKRRGYGG
                     SRNGKGRKGRKGRRSDD"
ORIGIN      
        1 atgaagatca ccccgctcct cgtgctcctc gccaccttcc tcggctgtgc gatgatccgc
       61 cagtcggagg gcgcctccag caccaccacc acctccgcct cggccaccac caccactgcc
      121 gcctccgcaa ccacctccgc ctcggccgcc accaccacca ctgccgcttc ggactccacc
      181 acgacaacca ctgaatcatc atcactagtc gcatctggca caaaaaagca ggtcataaga
      241 catgaaaaac gtaagcgcca taggcccaga aagatcaggc gaactaaaag gaggggatac
      301 ggcggaagtc gcaacggtaa aggacgcaag gggcgcaagg gccgcaggtc cgacgactga