Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_017144259 971 bp mRNA linear INV 09-DEC-2024 (LOC108059165), mRNA. ACCESSION XM_017144259 VERSION XM_017144259.3 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Dec 9, 2024 this sequence version replaced XM_017144259.2. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..971 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..971 /gene="LOC108059165" /note="uncharacterized LOC108059165; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 Protein" /db_xref="GeneID:108059165" CDS 99..722 /gene="LOC108059165" /codon_start=1 /product="uncharacterized protein" /protein_id="XP_016999748.2" /db_xref="GeneID:108059165" /translation="MELAGIQIYRLLLLLLYFGGILAFGGHSHCKDCDQYKNTVPVRC KYLLEADHVFERKCGGTYPLMAFTKFRDTFVKTGEPFALYMPNTLDHVMVLMKDSALQ SCDRLQLADVTTFFCLDDSANETIKLDVAHMYCFPFHIQLPDDLMQECLTENKMSKRH LDDVLRTRRGVIHYTFGESRGHRWFISGYFWPLLLQLVQLLRLLLLQ" ORIGIN 1 tttgccgcag ctcgaaatga atcgatttcg agacacactg acgcacagac ttggatttga 61 atcggaaacg gagacacagg taaaacttgg gattgtggat ggagctggcc gggattcaga 121 tatatcggct attgctattg ctgctttatt tcggcggcat cttggccttc ggcgggcaca 181 gccattgcaa ggactgcgat cagtacaaga atacggtgcc cgtgagatgc aaatacttgc 241 tggaggcgga ccatgtcttc gagcgaaagt gcggcgggac atatcccctg atggcgttca 301 ccaagtttcg cgataccttc gtgaagaccg gcgagccgtt cgccctgtat atgccgaata 361 ctttggacca tgtgatggtg ctgatgaagg actcggcgct gcagagctgc gaccgcctgc 421 agctggccga tgtgaccacg ttcttctgcc tggacgatag tgccaatgag acgatcaaac 481 tggacgtggc ccacatgtac tgcttcccgt ttcacatcca gctgccggac gacctgatgc 541 aggagtgcct cacggagaac aagatgagca agcggcacct ggacgatgtc ctccgcaccc 601 gacgcggcgt catccactat accttcggcg agagtcgggg ccaccggtgg ttcatttctg 661 gatatttctg gccacttctc ctccagctcg tacagctcct gcggctcctc ctgctccaat 721 gagttgatga tgagtcgtaa atttttatgc gagctgccat aaagattgat cggttaagcc 781 aaaggggaaa tggcattaaa caaaaattgc ttaaaacaaa aaagtgaact aaagtcaatg 841 gatatatata tacatgtatg gattgattgg aagccttatc gctggccttg ctcctggcca 901 tctcctgcga accgcggggc ccttgttgag tatttatttt atggcaaaac aaattaaact 961 gtattaacgc a