Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii uncharacterized protein


LOCUS       XM_017144259             971 bp    mRNA    linear   INV 09-DEC-2024
            (LOC108059165), mRNA.
ACCESSION   XM_017144259
VERSION     XM_017144259.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017144259.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..971
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..971
                     /gene="LOC108059165"
                     /note="uncharacterized LOC108059165; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 1
                     Protein"
                     /db_xref="GeneID:108059165"
     CDS             99..722
                     /gene="LOC108059165"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_016999748.2"
                     /db_xref="GeneID:108059165"
                     /translation="MELAGIQIYRLLLLLLYFGGILAFGGHSHCKDCDQYKNTVPVRC
                     KYLLEADHVFERKCGGTYPLMAFTKFRDTFVKTGEPFALYMPNTLDHVMVLMKDSALQ
                     SCDRLQLADVTTFFCLDDSANETIKLDVAHMYCFPFHIQLPDDLMQECLTENKMSKRH
                     LDDVLRTRRGVIHYTFGESRGHRWFISGYFWPLLLQLVQLLRLLLLQ"
ORIGIN      
        1 tttgccgcag ctcgaaatga atcgatttcg agacacactg acgcacagac ttggatttga
       61 atcggaaacg gagacacagg taaaacttgg gattgtggat ggagctggcc gggattcaga
      121 tatatcggct attgctattg ctgctttatt tcggcggcat cttggccttc ggcgggcaca
      181 gccattgcaa ggactgcgat cagtacaaga atacggtgcc cgtgagatgc aaatacttgc
      241 tggaggcgga ccatgtcttc gagcgaaagt gcggcgggac atatcccctg atggcgttca
      301 ccaagtttcg cgataccttc gtgaagaccg gcgagccgtt cgccctgtat atgccgaata
      361 ctttggacca tgtgatggtg ctgatgaagg actcggcgct gcagagctgc gaccgcctgc
      421 agctggccga tgtgaccacg ttcttctgcc tggacgatag tgccaatgag acgatcaaac
      481 tggacgtggc ccacatgtac tgcttcccgt ttcacatcca gctgccggac gacctgatgc
      541 aggagtgcct cacggagaac aagatgagca agcggcacct ggacgatgtc ctccgcaccc
      601 gacgcggcgt catccactat accttcggcg agagtcgggg ccaccggtgg ttcatttctg
      661 gatatttctg gccacttctc ctccagctcg tacagctcct gcggctcctc ctgctccaat
      721 gagttgatga tgagtcgtaa atttttatgc gagctgccat aaagattgat cggttaagcc
      781 aaaggggaaa tggcattaaa caaaaattgc ttaaaacaaa aaagtgaact aaagtcaatg
      841 gatatatata tacatgtatg gattgattgg aagccttatc gctggccttg ctcctggcca
      901 tctcctgcga accgcggggc ccttgttgag tatttatttt atggcaaaac aaattaaact
      961 gtattaacgc a