Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii adenosine 5'-monophosphoramidase


LOCUS       XM_017144212             676 bp    mRNA    linear   INV 09-DEC-2024
            HINT3 (LOC108059122), mRNA.
ACCESSION   XM_017144212
VERSION     XM_017144212.2
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Oct 18, 2021 this sequence version replaced XM_017144212.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..676
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..676
                     /gene="LOC108059122"
                     /note="adenosine 5'-monophosphoramidase HINT3; Derived by
                     automated computational analysis using gene prediction
                     method: Gnomon. Supporting evidence includes similarity
                     to: 2 Proteins"
                     /db_xref="GeneID:108059122"
     CDS             181..609
                     /gene="LOC108059122"
                     /codon_start=1
                     /product="adenosine 5'-monophosphoramidase HINT3"
                     /protein_id="XP_016999701.1"
                     /db_xref="GeneID:108059122"
                     /translation="MAEDNCIFCKISSGQEPTSVLEMETDEFVIFKDIKPASQHHYLA
                     VTKKHYISLKDLDKSHDPLVSRMESGLKEFLTGKGISVQDALFGFHLPPFITVKHLHM
                     HAIAPRSEMGFLSRLIFRPSVWFKTADEARAYLSQVESSQ"
     misc_feature    193..528
                     /gene="LOC108059122"
                     /note="Scavenger mRNA decapping enzyme C-term binding;
                     Region: DcpS_C; pfam11969"
                     /db_xref="CDD:463415"
     polyA_site      676
                     /gene="LOC108059122"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 tattgttaat ttgtcctacg gaacacttta agcgtaataa aaagcttttc ttatccaaga
       61 aataaatcca gatttggcgg gaaaaaagcg gaattggcag ccctgcttag tgcacctaat
      121 cagctgccaa agtacaaact cccatatttt atattactaa atttaatcgt atattaagcc
      181 atggcggagg acaactgcat tttctgcaaa atatccagtg gccaggagcc cacaagtgtt
      241 ttggaaatgg aaaccgatga gtttgtcatc tttaaggaca tcaagcccgc ttcccagcac
      301 cattatttgg ctgtaaccaa aaagcactac atcagcctaa aggatctgga caaatcccac
      361 gatcccttgg tctcacggat ggagagcggc ttgaaggagt tcctaactgg caagggaatt
      421 tccgtccagg atgcgctttt tgggttccac ctgccgccgt tcataacggt aaaacacctt
      481 cacatgcatg ccattgcccc acgatcggaa atgggcttcc tatcgcgatt aatcttcaga
      541 ccttccgttt ggttcaaaac cgccgacgag gcgcgggctt acctttccca agtagaaagc
      601 tcgcagtgaa ctgggattac aataaataga tcatttgtag ataaagtcgt ggttgatcta
      661 ataaataaag ccaaac