Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_017144212 676 bp mRNA linear INV 09-DEC-2024 HINT3 (LOC108059122), mRNA. ACCESSION XM_017144212 VERSION XM_017144212.2 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Oct 18, 2021 this sequence version replaced XM_017144212.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..676 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..676 /gene="LOC108059122" /note="adenosine 5'-monophosphoramidase HINT3; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 2 Proteins" /db_xref="GeneID:108059122" CDS 181..609 /gene="LOC108059122" /codon_start=1 /product="adenosine 5'-monophosphoramidase HINT3" /protein_id="XP_016999701.1" /db_xref="GeneID:108059122" /translation="MAEDNCIFCKISSGQEPTSVLEMETDEFVIFKDIKPASQHHYLA VTKKHYISLKDLDKSHDPLVSRMESGLKEFLTGKGISVQDALFGFHLPPFITVKHLHM HAIAPRSEMGFLSRLIFRPSVWFKTADEARAYLSQVESSQ" misc_feature 193..528 /gene="LOC108059122" /note="Scavenger mRNA decapping enzyme C-term binding; Region: DcpS_C; pfam11969" /db_xref="CDD:463415" polyA_site 676 /gene="LOC108059122" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 tattgttaat ttgtcctacg gaacacttta agcgtaataa aaagcttttc ttatccaaga 61 aataaatcca gatttggcgg gaaaaaagcg gaattggcag ccctgcttag tgcacctaat 121 cagctgccaa agtacaaact cccatatttt atattactaa atttaatcgt atattaagcc 181 atggcggagg acaactgcat tttctgcaaa atatccagtg gccaggagcc cacaagtgtt 241 ttggaaatgg aaaccgatga gtttgtcatc tttaaggaca tcaagcccgc ttcccagcac 301 cattatttgg ctgtaaccaa aaagcactac atcagcctaa aggatctgga caaatcccac 361 gatcccttgg tctcacggat ggagagcggc ttgaaggagt tcctaactgg caagggaatt 421 tccgtccagg atgcgctttt tgggttccac ctgccgccgt tcataacggt aaaacacctt 481 cacatgcatg ccattgcccc acgatcggaa atgggcttcc tatcgcgatt aatcttcaga 541 ccttccgttt ggttcaaaac cgccgacgag gcgcgggctt acctttccca agtagaaagc 601 tcgcagtgaa ctgggattac aataaataga tcatttgtag ataaagtcgt ggttgatcta 661 ataaataaag ccaaac