Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_017144209 1613 bp mRNA linear INV 09-DEC-2024 (Tango4), mRNA. ACCESSION XM_017144209 VERSION XM_017144209.3 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Dec 9, 2024 this sequence version replaced XM_017144209.2. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..1613 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..1613 /gene="Tango4" /note="transport and golgi organization 4; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 2 Proteins" /db_xref="GeneID:108059119" CDS 102..1535 /gene="Tango4" /codon_start=1 /product="pleiotropic regulator 1" /protein_id="XP_016999698.1" /db_xref="GeneID:108059119" /translation="MEDVQKHSVHTLIFRSLKRTHDLFVSNQGNLPEIDERLEKLRRS IKAKDSYGLVLDKAVKMGEARKGAGGQMPGDKLLAITEGSPEGSSSAVVKYNPGGGRI TEKTAPLVTGTHTSLVRASLAGNSGDKGANGGASNLQLIPKKAPTIPKPKWHAPWKLS RVISGHLGWVRCIAVEPGNEWFATGAGDRVIKIWDLASGKLKLSLTGHVSTVRGVAVS SKHPYLFSCGEDRQVKCWDLEYNKVIRHYHGHLSAVYSLALHPTIDVLATSGRDSTAR IWDMRTKANVHTLTGHTNTVASVVAQATNPQIITGSHDSTVRLWDLAAGKSVCTLTNH KKSVRSIVLHPSLYMFASASPDNIKQWRCPEGNFVQNISGHTAIVNCMAANNDGVLVS GGDNGTMFFWDWRTGYNFQRFQAPVQPGSMDSEAGIFAMCFDQSGTRLITAEADKTIK VYKEDDEASEESHPVNWRPELLKRRKF" misc_feature 576..1460 /gene="Tango4" /note="WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from...; Region: WD40; cd00200" /db_xref="CDD:238121" misc_feature order(597..599,651..653,663..665,681..686,720..725, 777..779,789..791,807..812,846..851,900..902,915..917, 933..938,975..977,1026..1028,1041..1043,1059..1064, 1098..1103,1155..1157,1167..1169,1182..1187,1221..1226, 1272..1274,1287..1289,1305..1310,1344..1349,1425..1427, 1437..1439,1455..1460) /gene="Tango4" /note="structural tetrad [active]" /db_xref="CDD:238121" misc_feature 615..722 /gene="Tango4" /note="WD40 repeat [structural motif]; Region: WD40 repeat" /db_xref="CDD:293791" misc_feature 738..848 /gene="Tango4" /note="WD40 repeat [structural motif]; Region: WD40 repeat" /db_xref="CDD:293791" misc_feature 861..971 /gene="Tango4" /note="WD40 repeat [structural motif]; Region: WD40 repeat" /db_xref="CDD:293791" misc_feature 990..1097 /gene="Tango4" /note="WD40 repeat [structural motif]; Region: WD40 repeat" /db_xref="CDD:293791" misc_feature 1113..1220 /gene="Tango4" /note="WD40 repeat [structural motif]; Region: WD40 repeat" /db_xref="CDD:293791" misc_feature 1242..1364 /gene="Tango4" /note="WD40 repeat [structural motif]; Region: WD40 repeat" /db_xref="CDD:293791" misc_feature 1383..1457 /gene="Tango4" /note="WD40 repeat [structural motif]; Region: WD40 repeat" /db_xref="CDD:293791" polyA_site 1613 /gene="Tango4" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 gatagacaga ccactgtgaa tggctgtttg gtggccaaac gcaaaagccg cattttttaa 61 tctattttag caaataaaca agcaaataac agccaactgc catggaggat gtgcaaaagc 121 acagcgtgca caccctgata ttccgttccc tgaagcgcac ccacgacctg ttcgtctcga 181 accagggaaa tctgccggag atcgacgagc gactggagaa gctgcggcgg tccatcaagg 241 ccaaggacag ctatggactg gttctggaca aggcggtgaa gatgggggag gcgaggaagg 301 gagccggcgg ccaaatgccg ggcgacaagc tattggccat cacagaaggt tcacccgaag 361 gttcatccag cgccgtggtc aagtacaatc ccggtggcgg ccggataacg gagaagacag 421 caccgctggt caccggcaca cacacatccc tggtgcgcgc ctcgctggcc ggcaattccg 481 gggacaaggg cgccaatggc ggcgccagca atctgcagct gatacccaag aaggcgccga 541 ccataccgaa gcccaagtgg cacgccccct ggaagctgtc gcgcgtcatc tccggccatt 601 tgggctgggt gcgctgcata gccgtggagc cgggcaacga gtggttcgcc acgggggccg 661 gcgatcgggt catcaagatc tgggacctgg ccagcggcaa gctgaagcta tcgctcaccg 721 gccatgtgag cacggtgcgc ggcgtggccg tcagctcgaa gcatccgtat ctgttcagct 781 gcggcgagga tcggcaggtc aagtgctggg atctggagta caacaaggtg atacgacact 841 accacggcca tctgtccgcc gtctactcgc tggccctgca tcccaccatc gatgtgctgg 901 ccacctcggg ccgcgactcc acggcgcgca tctgggacat gcggaccaag gcgaatgtgc 961 acacgctgac gggccacacg aacacggtgg ccagcgtggt tgcccaggcc acgaatcccc 1021 agatcatcac cggctcccac gactccaccg tgcggctgtg ggatttggcc gccggcaaga 1081 gcgtctgcac gctgaccaac cacaagaaat ccgtgcgcag catcgtcctg catccgtcgc 1141 tctacatgtt cgcctccgcc tcgccggaca acatcaagca gtggcgctgt ccggagggca 1201 actttgtgca gaacatctcc ggccacacgg ccattgtcaa ctgcatggcg gccaacaatg 1261 atggcgtcct cgtttcgggc ggcgacaacg gcaccatgtt cttctgggac tggcgcaccg 1321 gctacaattt ccagcgcttc caggcgcccg tccagccggg ctccatggac agcgaggcgg 1381 gcatattcgc catgtgcttc gaccaatcgg gcaccaggct aatcaccgcc gaggcggaca 1441 agacgatcaa ggtgtacaag gaggacgacg aggccagcga ggagtcgcac ccggttaact 1501 ggcggcccga gctgctcaag cgacgcaaat tctaggcacc tagtttctaa gctaccgtag 1561 actatgattt tccaaacgat ttcattaaac aaatacttta aagacgctct cga