Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii small nuclear ribonucleoprotein G


LOCUS       XM_017144186             513 bp    mRNA    linear   INV 09-DEC-2024
            (SNRPG), mRNA.
ACCESSION   XM_017144186
VERSION     XM_017144186.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017144186.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..513
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..513
                     /gene="SNRPG"
                     /note="small nuclear ribonucleoprotein G; Derived by
                     automated computational analysis using gene prediction
                     method: Gnomon. Supporting evidence includes similarity
                     to: 4 Proteins"
                     /db_xref="GeneID:108059108"
     CDS             121..351
                     /gene="SNRPG"
                     /codon_start=1
                     /product="probable small nuclear ribonucleoprotein G"
                     /protein_id="XP_016999675.1"
                     /db_xref="GeneID:108059108"
                     /translation="MSKAHPPELKKYMDKRMMLKLNGGRAVTGILRGFDPFMNVVLDD
                     TVEECKDNTKNNIGMVVIRGNSIVMVEALDRV"
     misc_feature    133..342
                     /gene="SNRPG"
                     /note="Sm protein G; Region: Sm_G; cd01719"
                     /db_xref="CDD:212466"
     misc_feature    order(142..144,154..156,178..180,193..195,232..234,
                     295..297,301..306,310..312,319..333,337..339)
                     /gene="SNRPG"
                     /note="heptamer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:212466"
     misc_feature    order(169..189,193..231,235..249)
                     /gene="SNRPG"
                     /note="Sm1 motif; other site"
                     /db_xref="CDD:212466"
     misc_feature    order(229..231,235..237,307..309,313..315)
                     /gene="SNRPG"
                     /note="RNA binding site [nucleotide binding]; other site"
                     /db_xref="CDD:212466"
     misc_feature    295..330
                     /gene="SNRPG"
                     /note="Sm2 motif; other site"
                     /db_xref="CDD:212466"
     polyA_site      513
                     /gene="SNRPG"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 gagccgtagt cgatactatc gccagcagcc acaccaccgc tgtacaagat tgtgtcatca
       61 ctaccgttaa ggccgcattt ttactaggtt ttcgcgtttt tagcaaatta aaactcaaag
      121 atgtcgaagg cccatccccc agagctgaaa aagtacatgg acaagcgaat gatgctgaaa
      181 ctgaacggag gacgcgccgt caccggcatt ttgcgaggct tcgatccctt catgaatgtg
      241 gtcctggacg acacggtgga ggagtgcaag gacaacacga agaacaacat cggcatggtg
      301 gtaatccgcg gcaacagcat cgtcatggtg gaggctctgg acagggttta gcacccgcct
      361 cggaacccga tcccctccag ctcctcaatc gttagccgta gtgtctagtc ttaaggctcc
      421 gaaacattca tgcgctatag accgtcaaga aaatatacaa attcgtaaat aaattatatt
      481 ctacagagac aatgtaatcc ctcgccaaac caa