Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_017144186 513 bp mRNA linear INV 09-DEC-2024 (SNRPG), mRNA. ACCESSION XM_017144186 VERSION XM_017144186.3 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Dec 9, 2024 this sequence version replaced XM_017144186.2. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..513 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..513 /gene="SNRPG" /note="small nuclear ribonucleoprotein G; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 4 Proteins" /db_xref="GeneID:108059108" CDS 121..351 /gene="SNRPG" /codon_start=1 /product="probable small nuclear ribonucleoprotein G" /protein_id="XP_016999675.1" /db_xref="GeneID:108059108" /translation="MSKAHPPELKKYMDKRMMLKLNGGRAVTGILRGFDPFMNVVLDD TVEECKDNTKNNIGMVVIRGNSIVMVEALDRV" misc_feature 133..342 /gene="SNRPG" /note="Sm protein G; Region: Sm_G; cd01719" /db_xref="CDD:212466" misc_feature order(142..144,154..156,178..180,193..195,232..234, 295..297,301..306,310..312,319..333,337..339) /gene="SNRPG" /note="heptamer interface [polypeptide binding]; other site" /db_xref="CDD:212466" misc_feature order(169..189,193..231,235..249) /gene="SNRPG" /note="Sm1 motif; other site" /db_xref="CDD:212466" misc_feature order(229..231,235..237,307..309,313..315) /gene="SNRPG" /note="RNA binding site [nucleotide binding]; other site" /db_xref="CDD:212466" misc_feature 295..330 /gene="SNRPG" /note="Sm2 motif; other site" /db_xref="CDD:212466" polyA_site 513 /gene="SNRPG" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 gagccgtagt cgatactatc gccagcagcc acaccaccgc tgtacaagat tgtgtcatca 61 ctaccgttaa ggccgcattt ttactaggtt ttcgcgtttt tagcaaatta aaactcaaag 121 atgtcgaagg cccatccccc agagctgaaa aagtacatgg acaagcgaat gatgctgaaa 181 ctgaacggag gacgcgccgt caccggcatt ttgcgaggct tcgatccctt catgaatgtg 241 gtcctggacg acacggtgga ggagtgcaag gacaacacga agaacaacat cggcatggtg 301 gtaatccgcg gcaacagcat cgtcatggtg gaggctctgg acagggttta gcacccgcct 361 cggaacccga tcccctccag ctcctcaatc gttagccgta gtgtctagtc ttaaggctcc 421 gaaacattca tgcgctatag accgtcaaga aaatatacaa attcgtaaat aaattatatt 481 ctacagagac aatgtaatcc ctcgccaaac caa