PREDICTED: Drosophila takahashii chromatin accessibility complex

LOCUS       XM_017144182             695 bp    mRNA    linear   INV 09-DEC-2024
            protein 1 (Chrac-16), mRNA.
ACCESSION   XM_017144182
VERSION     XM_017144182.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017144182.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..695
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..695
                     /gene="Chrac-16"
                     /note="chromatin accessibility complex protein 1; Derived
                     by automated computational analysis using gene prediction
                     method: Gnomon. Supporting evidence includes similarity
                     to: 1 Protein"
                     /db_xref="GeneID:108059105"
     CDS             65..457
                     /gene="Chrac-16"
                     /codon_start=1
                     /product="chromatin accessibility complex 16kD protein"
                     /protein_id="XP_016999671.2"
                     /db_xref="GeneID:108059105"
                     /translation="MVEPKMQPPVERAPNAETVLPLSRVRTIMKSSMDTGLITNEVLF
                     LMTKCTELFVRHLAGEAYTETFRQKPGETLKYEHLSQLVNKRKNLEFLLQIVPEKIRV
                     HEFQEMLRLNRSAGSDDDDSDSGSESDE"
     misc_feature    122..352
                     /gene="Chrac-16"
                     /note="histone-fold domain found in chromatin
                     accessibility complex protein 1 (CHRAC-1) and similar
                     proteins; Region: HFD_CHRAC1-like; cd22924"
                     /db_xref="CDD:467049"
     misc_feature    order(170..175,182..190,194..202,206..214,218..241,
                     248..250,272..292,299..301,326..328,335..340,347..349)
                     /gene="Chrac-16"
                     /note="heterodimer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:467049"
ORIGIN      
        1 gataagtatc ggcggcatat cgatagttcg tgaacccaag ccaaacaacg aaattttaat
       61 aataatggtg gaacccaaga tgcagccgcc cgtggagcga gcgcccaacg ccgagaccgt
      121 cctgcccctc agccgggtgc gcaccatcat gaagagctcc atggacacgg ggctgatcac
      181 caacgaggtg ctcttcctga tgaccaagtg caccgagctg ttcgtccgcc atttggcggg
      241 agaagcgtac acggaaacat tccgccaaaa gccgggcgaa accctgaagt acgagcatct
      301 ctcgcagctg gtcaacaaga ggaagaacct cgagttcctg ctgcagatcg tgccggagaa
      361 gatccgggtg cacgagttcc aggagatgct gcgattgaac cgatccgccg gcagcgacga
      421 cgacgattcc gattccggtt cagagtcgga tgaatgactc gaactggact tggacttgta
      481 ccgtccccag actgatttta acgcctccct caccccgcca tctcttagtt taggccagcc
      541 ctcccccact agataagtta acgattgtgt atacataacc cctgattaat aaagagcaaa
      601 tatgagcagt gtgtcctcca aatgaccacc agatcgtgag atgtctgcgt ctgatagcaa
      661 acctcgttgt ctttccattt caaccgatta aatat