Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_017144181 949 bp mRNA linear INV 09-DEC-2024 (LOC108059104), mRNA. ACCESSION XM_017144181 VERSION XM_017144181.3 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Dec 9, 2024 this sequence version replaced XM_017144181.2. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..949 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..949 /gene="LOC108059104" /note="uncharacterized LOC108059104; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 Protein" /db_xref="GeneID:108059104" CDS 111..794 /gene="LOC108059104" /codon_start=1 /product="uncharacterized protein" /protein_id="XP_016999670.1" /db_xref="GeneID:108059104" /translation="MVNPPVNGGSSRLALCLIHFVLAVISGWGLKRSTGSQAMAAFGI YFGHSLLCLLRHTHPNPGALQRLLCDKSRRYSCVLFVTLVVGELQAVNPATRMADFFG ADWERLAFGLWSCVLTLAVTSLWFGGPGSRSSSSSSLGATFVRLDAAQLGLCVLWNVQ CLWRIAIVDEHWWSLGLALLVLLNHFVLWRLPLHYNITQLEVATVGMCFSTIFALNAI QEQLDAVAS" polyA_site 949 /gene="LOC108059104" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 cctatcgata gttcagtgtg ctcgtattca aaacgatttc ttgtgcttaa aaattaaatt 61 aaataaataa attaattaga agccaggaca ggaggctcaa ccagcgggcc atggtgaacc 121 cgccggtcaa tggcggttcc tcccgcctgg ccctgtgcct catccacttc gtgctggccg 181 tgatctccgg ctggggcctg aaacggagca ccggcagcca ggcgatggcc gccttcggga 241 tctacttcgg gcacagcctg ctctgcctgc tgcggcacac gcaccccaat ccgggtgcac 301 tgcagcggct gctgtgcgac aagtcgcgcc gctactcctg cgtcctcttc gtcaccttgg 361 tggtgggcga gctgcaggcg gtgaatccgg ccacccgcat ggcggacttc ttcggcgccg 421 actgggagcg tctggccttc gggctctgga gctgcgtcct cacgctggcg gtcaccagcc 481 tgtggttcgg cggccccggc agtcgcagca gcagcagcag ctcgctgggc gccaccttcg 541 tccggctgga tgccgcccaa ctgggcctgt gcgtcctctg gaacgtccag tgcctgtggc 601 gcatcgccat cgtcgacgag cactggtggt ccctcggcct cgcgctgctc gtcctgctca 661 accacttcgt cctgtggcgc ctgccgctgc actacaacat cacccagctg gaggtggcca 721 ccgtgggcat gtgcttcagc accatcttcg cgctgaacgc catccaggag caactggatg 781 cggtggccag ctgaggacag ctgcaaggga ttggggaacc aggcactggg gactggggcc 841 tcggttgctt agttctaaac gaaagcacac acatttatta actactaacc gttagctgta 901 cgttgttgat cgattctttt gtgtaataaa ccagtgttct tcatttaaa