Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii ileal sodium/bile acid


LOCUS       XM_017144180            1573 bp    mRNA    linear   INV 09-DEC-2024
            cotransporter (LOC108059103), mRNA.
ACCESSION   XM_017144180
VERSION     XM_017144180.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017144180.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1573
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..1573
                     /gene="LOC108059103"
                     /note="ileal sodium/bile acid cotransporter; Derived by
                     automated computational analysis using gene prediction
                     method: Gnomon. Supporting evidence includes similarity
                     to: 2 Proteins"
                     /db_xref="GeneID:108059103"
     CDS             15..1382
                     /gene="LOC108059103"
                     /codon_start=1
                     /product="ileal sodium/bile acid cotransporter"
                     /protein_id="XP_016999669.2"
                     /db_xref="GeneID:108059103"
                     /translation="MGDTKKNRGLQILSLLLILRLRGASSDLAGDWLVDYGQQELKLL
                     EGESEQVPLHIYNVIPKDSELDYYFLVYSGDEGRASSQLKIPKEDFDLVGSWRGLVDV
                     TGLRFGYSSLEVELHSGAEVEPYANPLRIAVLRSRVVDERVTTYVSAALALLMFLNLG
                     TVLDMQRLAGIICRPVGPVVGVASRFVLMPALGFGLGRGLWPDAWAMQLALFYTALAP
                     SGGLANVCAVFLKGNINLSVATTTINCLLALAFLPLWILVLGRLLYEDDELAVPFGQL
                     SGGAAALVACLAIGVLLRLCVPRTTRFIFRFLKPLSVVLSLCLVGLTVGLNWFVFMEF
                     TWQVLVAAVCLPLAGYLATYLLSKLLCRSATDALTLSIEASVLNMTMPIVLLQSSQLE
                     QPQLDLVLVVPIASSLLSLVLVILFYGVRRCLGWNKRQDADGFDHKELIAEHEEHEGD
                     IYQRP"
     misc_feature    441..1169
                     /gene="LOC108059103"
                     /note="Predicted Na+-dependent transporter YfeH [General
                     function prediction only]; Region: YfeH; COG0385"
                     /db_xref="CDD:440154"
     polyA_site      1573
                     /gene="LOC108059103"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 tcgaacgacg cagcatgggc gatacgaaaa agaaccgggg actgcagatc ctgtcactac
       61 ttctgatcct gcgactccgg ggagcgagct ccgacctcgc tggcgattgg ctggtggatt
      121 atggccagca ggagctgaaa ttgctggagg gcgaaagtga gcaggtgcca ctgcatatat
      181 acaatgtgat acccaaggac tccgagctgg attactattt cttggtctac tcgggcgatg
      241 aggggcgcgc ctcctcccag ctgaagatac caaaggagga tttcgatctg gtgggcagct
      301 ggcggggatt ggtggatgtg acgggcctgc gatttggcta cagttcgctg gaggtggaac
      361 ttcactcggg tgcagaggtg gaaccctatg ctaatcccct gcgcattgca gtgctgagat
      421 ctcgagtggt ggacgaaagg gtgaccacct atgtgtccgc cgctttggct ctgctgatgt
      481 tcctcaatct ggggacggtg ctggatatgc aacggctggc ggggattatc tgccgacccg
      541 ttgggcccgt ggtgggcgtg gccagtcggt ttgtgctaat gcccgccctg ggattcggac
      601 tggggcgtgg cctctggccg gatgcctggg ccatgcagct ggctctcttc tacaccgccc
      661 tggcgcccag cggcggactg gccaacgtgt gcgccgtgtt cctcaagggc aacatcaatc
      721 tgtcggtggc caccaccacg atcaattgcc tgctggccct ggccttcctg cccctctgga
      781 tcctggtgct gggcaggctg ctctacgagg acgacgagct ggccgtcccg tttggccagc
      841 tctcgggcgg agcggctgcc ctggtggcct gcctggccat tggcgtcctg ctgcgactgt
      901 gcgtccctag gaccacgcgc ttcatcttcc gcttcctgaa gcccctgtcc gtcgtcctca
      961 gcctgtgcct cgtggggctg accgtggggc tcaactggtt cgtcttcatg gagtttacct
     1021 ggcaggttct ggtggccgcc gtgtgcctgc ccctggccgg ctacctggcc acctacctgc
     1081 tgtccaagct cctctgccgc tcggccaccg atgccctgac cctctcgatc gaggccagtg
     1141 tgctgaacat gaccatgccc attgtgctgc tgcaatctag tcagctggag cagccacagc
     1201 tggatctcgt cctggtggtg cccattgcct cctcgctgct ttccctggtc ctggtgatcc
     1261 ttttctatgg ggtgcgtcgc tgtttgggct ggaacaagcg gcaggatgcc gatggctttg
     1321 accacaagga gctgattgct gagcacgaag agcacgaggg tgatatctac cagcgacctt
     1381 aagtctctaa gtttccaagt tacaggcttt tagtgtatac agtaatcaat gtttttctta
     1441 gactttgaca tttttataga atatataaat attcgatatt tattgtgaat ttgtaagtgt
     1501 aattgttaat acttatactt agatactaat ttagtttaaa aattgataaa tattatacaa
     1561 agttttaaaa gcg