Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_017144180 1573 bp mRNA linear INV 09-DEC-2024 cotransporter (LOC108059103), mRNA. ACCESSION XM_017144180 VERSION XM_017144180.3 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Dec 9, 2024 this sequence version replaced XM_017144180.2. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..1573 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..1573 /gene="LOC108059103" /note="ileal sodium/bile acid cotransporter; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 2 Proteins" /db_xref="GeneID:108059103" CDS 15..1382 /gene="LOC108059103" /codon_start=1 /product="ileal sodium/bile acid cotransporter" /protein_id="XP_016999669.2" /db_xref="GeneID:108059103" /translation="MGDTKKNRGLQILSLLLILRLRGASSDLAGDWLVDYGQQELKLL EGESEQVPLHIYNVIPKDSELDYYFLVYSGDEGRASSQLKIPKEDFDLVGSWRGLVDV TGLRFGYSSLEVELHSGAEVEPYANPLRIAVLRSRVVDERVTTYVSAALALLMFLNLG TVLDMQRLAGIICRPVGPVVGVASRFVLMPALGFGLGRGLWPDAWAMQLALFYTALAP SGGLANVCAVFLKGNINLSVATTTINCLLALAFLPLWILVLGRLLYEDDELAVPFGQL SGGAAALVACLAIGVLLRLCVPRTTRFIFRFLKPLSVVLSLCLVGLTVGLNWFVFMEF TWQVLVAAVCLPLAGYLATYLLSKLLCRSATDALTLSIEASVLNMTMPIVLLQSSQLE QPQLDLVLVVPIASSLLSLVLVILFYGVRRCLGWNKRQDADGFDHKELIAEHEEHEGD IYQRP" misc_feature 441..1169 /gene="LOC108059103" /note="Predicted Na+-dependent transporter YfeH [General function prediction only]; Region: YfeH; COG0385" /db_xref="CDD:440154" polyA_site 1573 /gene="LOC108059103" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 tcgaacgacg cagcatgggc gatacgaaaa agaaccgggg actgcagatc ctgtcactac 61 ttctgatcct gcgactccgg ggagcgagct ccgacctcgc tggcgattgg ctggtggatt 121 atggccagca ggagctgaaa ttgctggagg gcgaaagtga gcaggtgcca ctgcatatat 181 acaatgtgat acccaaggac tccgagctgg attactattt cttggtctac tcgggcgatg 241 aggggcgcgc ctcctcccag ctgaagatac caaaggagga tttcgatctg gtgggcagct 301 ggcggggatt ggtggatgtg acgggcctgc gatttggcta cagttcgctg gaggtggaac 361 ttcactcggg tgcagaggtg gaaccctatg ctaatcccct gcgcattgca gtgctgagat 421 ctcgagtggt ggacgaaagg gtgaccacct atgtgtccgc cgctttggct ctgctgatgt 481 tcctcaatct ggggacggtg ctggatatgc aacggctggc ggggattatc tgccgacccg 541 ttgggcccgt ggtgggcgtg gccagtcggt ttgtgctaat gcccgccctg ggattcggac 601 tggggcgtgg cctctggccg gatgcctggg ccatgcagct ggctctcttc tacaccgccc 661 tggcgcccag cggcggactg gccaacgtgt gcgccgtgtt cctcaagggc aacatcaatc 721 tgtcggtggc caccaccacg atcaattgcc tgctggccct ggccttcctg cccctctgga 781 tcctggtgct gggcaggctg ctctacgagg acgacgagct ggccgtcccg tttggccagc 841 tctcgggcgg agcggctgcc ctggtggcct gcctggccat tggcgtcctg ctgcgactgt 901 gcgtccctag gaccacgcgc ttcatcttcc gcttcctgaa gcccctgtcc gtcgtcctca 961 gcctgtgcct cgtggggctg accgtggggc tcaactggtt cgtcttcatg gagtttacct 1021 ggcaggttct ggtggccgcc gtgtgcctgc ccctggccgg ctacctggcc acctacctgc 1081 tgtccaagct cctctgccgc tcggccaccg atgccctgac cctctcgatc gaggccagtg 1141 tgctgaacat gaccatgccc attgtgctgc tgcaatctag tcagctggag cagccacagc 1201 tggatctcgt cctggtggtg cccattgcct cctcgctgct ttccctggtc ctggtgatcc 1261 ttttctatgg ggtgcgtcgc tgtttgggct ggaacaagcg gcaggatgcc gatggctttg 1321 accacaagga gctgattgct gagcacgaag agcacgaggg tgatatctac cagcgacctt 1381 aagtctctaa gtttccaagt tacaggcttt tagtgtatac agtaatcaat gtttttctta 1441 gactttgaca tttttataga atatataaat attcgatatt tattgtgaat ttgtaagtgt 1501 aattgttaat acttatactt agatactaat ttagtttaaa aattgataaa tattatacaa 1561 agttttaaaa gcg