Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_017144178 1021 bp mRNA linear INV 09-DEC-2024 (Ubc7), mRNA. ACCESSION XM_017144178 VERSION XM_017144178.3 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Dec 9, 2024 this sequence version replaced XM_017144178.2. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..1021 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..1021 /gene="Ubc7" /note="ubiquitin conjugating enzyme 7; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 10 Proteins" /db_xref="GeneID:108059100" CDS 276..779 /gene="Ubc7" /codon_start=1 /product="ubiquitin-conjugating enzyme E2 G2" /protein_id="XP_016999667.1" /db_xref="GeneID:108059100" /translation="MAGSALRRLMAEYKQLTLDPPEGIVAGPISEDNFFEWEALIAGP EGTCFEGGVFPARLVFPPDYPLSPPKMKFTCDMFHPNIFADGRVCISILHAPGDDPMG YELSAERWSPVQSVEKILLSVVSMLAEPNDESGANVDAAIMWRERRDEFNAIARRLVR KTLGLPP" misc_feature 291..764 /gene="Ubc7" /note="Ubiquitin-conjugating enzyme E2, catalytic (UBCc) domain of ubiquitin-conjugating enzyme E2 G2 and related proteins; Region: UBCc_UBE2G2; cd23796" /db_xref="CDD:467416" polyA_site 1021 /gene="Ubc7" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 aaaaacccat tcgatacatt cgatataaat aaacaccgaa aggcttgtgt ttattatatt 61 acgacgtgtc tgcatttgac cctttcggcc gagcagagga tctctggcta gtgcgcgatc 121 gccgccgcag gacaagcagg acatcattcg ggaggacaag gaggagcgga gccgcaggaa 181 gcgccagcca agcgaggagg aggaagaacg aaacgaaagg gaaaggagaa ggagaagaga 241 aaccaccatc atcatcgaga tcgaggacat acaggatggc tggatccgcg ctgcgccgcc 301 taatggccga atacaaacag ttaacacttg acccgcccga gggcattgtg gccggcccca 361 tcagcgagga caacttcttc gagtgggagg cactgattgc cggacccgag ggcacttgct 421 tcgagggcgg cgtctttccc gcccggctcg tctttccacc cgactaccca ctgagtccgc 481 caaaaatgaa attcacttgt gatatgttcc atcccaacat cttcgccgac ggccgggtct 541 gcatatcaat actccacgcg cccggcgacg atcccatggg ctatgagctc tccgccgagc 601 gctggagtcc cgtccagagc gtcgagaaga tcttgctcag cgtggtcagc atgctggcgg 661 aacccaacga tgagagcggc gccaatgtgg atgccgccat catgtggcgc gagcggaggg 721 acgagttcaa cgccatcgcc cgacgcctgg tgcgcaaaac cctcggactg ccgccgtaga 781 ggatgaggat gatcaaaatg aactggactg gagccactgg accactggag ccatgtccgc 841 caccgtcgac cccaaaaact ttctatcccg aacccgaaca cgaacacgat tccaagattg 901 cgcctcacag aaaatgctaa cccacagttc cctaaaatcc tcgtcgagat ctaatcgaca 961 aagacgtttc aatttagcaa aaataaagaa cctagcaata aaatcgactg tcaaacacaa 1021 a