Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii Ribosomal protein S19a (RpS19a),


LOCUS       XM_017144177             678 bp    mRNA    linear   INV 09-DEC-2024
            mRNA.
ACCESSION   XM_017144177
VERSION     XM_017144177.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017144177.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..678
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..678
                     /gene="RpS19a"
                     /note="Ribosomal protein S19a; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 11
                     Proteins"
                     /db_xref="GeneID:108059099"
     CDS             82..552
                     /gene="RpS19a"
                     /codon_start=1
                     /product="small ribosomal subunit protein eS19A"
                     /protein_id="XP_016999666.1"
                     /db_xref="GeneID:108059099"
                     /translation="MPGVTVKDIDQHAVTKAVAVFLKKTGKLKVPDQMDIVKTAKFKE
                     LAPYDPDWFYVRCASILRHLYHRSPAGVGSITKIYGGRKRNGVHPSHFCRAADGAARK
                     ALQALEHARLVEKHPDGGRKLSSIGQRDLDRIANQIVVKQRDAAKQTGPLVISK"
     misc_feature    94..504
                     /gene="RpS19a"
                     /note="Ribosomal protein S19e; Region: Ribosomal_S19e;
                     pfam01090"
                     /db_xref="CDD:460058"
     polyA_site      678
                     /gene="RpS19a"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 ccacagctct cctctccacc actaaagcgc agccaacttc acgcgacttg ttcttttttc
       61 cggttgactt taacgagaaa gatgccaggc gtcacagtga aggatattga ccagcacgcg
      121 gttaccaagg cggtggccgt cttcttgaag aagactggca agttgaaggt gcccgaccag
      181 atggacatcg tgaagaccgc caaattcaag gagctggcgc cctacgatcc cgactggttc
      241 tacgtgcgct gcgcctcgat cctgcgccac ctgtaccacc gcagtcccgc tggcgtgggc
      301 tccatcacca agatctacgg cggccgcaag cgcaacggcg tccatccgtc gcacttctgc
      361 cgcgccgccg acggtgctgc ccgcaaggcc ctccaggcct tggagcacgc ccgcctggtc
      421 gagaagcacc ccgacggcgg ccgcaagctg agctccatcg gacagcggga tctggaccgt
      481 atcgccaacc agatcgtcgt gaagcagcgc gacgccgcca agcagaccgg gccccttgtt
      541 atttccaagt aaaccgacac acggcgccct tttcgaattc taaaatcgcg tttttagact
      601 tcatttgtat gcgctttttg tttgcacgaa agagatgaga gaaaataaaa ccaaccacaa
      661 tttgtaaaag tctacaaa