Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_017144177 678 bp mRNA linear INV 09-DEC-2024 mRNA. ACCESSION XM_017144177 VERSION XM_017144177.3 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Dec 9, 2024 this sequence version replaced XM_017144177.2. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..678 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..678 /gene="RpS19a" /note="Ribosomal protein S19a; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 11 Proteins" /db_xref="GeneID:108059099" CDS 82..552 /gene="RpS19a" /codon_start=1 /product="small ribosomal subunit protein eS19A" /protein_id="XP_016999666.1" /db_xref="GeneID:108059099" /translation="MPGVTVKDIDQHAVTKAVAVFLKKTGKLKVPDQMDIVKTAKFKE LAPYDPDWFYVRCASILRHLYHRSPAGVGSITKIYGGRKRNGVHPSHFCRAADGAARK ALQALEHARLVEKHPDGGRKLSSIGQRDLDRIANQIVVKQRDAAKQTGPLVISK" misc_feature 94..504 /gene="RpS19a" /note="Ribosomal protein S19e; Region: Ribosomal_S19e; pfam01090" /db_xref="CDD:460058" polyA_site 678 /gene="RpS19a" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 ccacagctct cctctccacc actaaagcgc agccaacttc acgcgacttg ttcttttttc 61 cggttgactt taacgagaaa gatgccaggc gtcacagtga aggatattga ccagcacgcg 121 gttaccaagg cggtggccgt cttcttgaag aagactggca agttgaaggt gcccgaccag 181 atggacatcg tgaagaccgc caaattcaag gagctggcgc cctacgatcc cgactggttc 241 tacgtgcgct gcgcctcgat cctgcgccac ctgtaccacc gcagtcccgc tggcgtgggc 301 tccatcacca agatctacgg cggccgcaag cgcaacggcg tccatccgtc gcacttctgc 361 cgcgccgccg acggtgctgc ccgcaaggcc ctccaggcct tggagcacgc ccgcctggtc 421 gagaagcacc ccgacggcgg ccgcaagctg agctccatcg gacagcggga tctggaccgt 481 atcgccaacc agatcgtcgt gaagcagcgc gacgccgcca agcagaccgg gccccttgtt 541 atttccaagt aaaccgacac acggcgccct tttcgaattc taaaatcgcg tttttagact 601 tcatttgtat gcgctttttg tttgcacgaa agagatgaga gaaaataaaa ccaaccacaa 661 tttgtaaaag tctacaaa