Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_017144062 639 bp mRNA linear INV 09-DEC-2024 (LOC108059031), mRNA. ACCESSION XM_017144062 VERSION XM_017144062.2 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Oct 18, 2021 this sequence version replaced XM_017144062.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..639 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..639 /gene="LOC108059031" /note="uncharacterized LOC108059031; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 Protein" /db_xref="GeneID:108059031" CDS 81..548 /gene="LOC108059031" /codon_start=1 /product="uncharacterized protein" /protein_id="XP_016999551.1" /db_xref="GeneID:108059031" /translation="MGIIGTLSMAHKVYSAHWLRETQDTQDGPDAGSRTRGRLPKWHR HRHQQQQVHVVVASPNRQSLESSHSTFTSHSESESESDSSNPSGDFIRTKRSRSCQSF QSFNGSPSKDLRQLVSCWWPLNICHEMRQKLHQIVEHSAEISVVWPSGSGDPA" misc_feature 351..>539 /gene="LOC108059031" /note="tyrosine aminotransferase; Provisional; Region: PTZ00433" /db_xref="CDD:185613" polyA_site 639 /gene="LOC108059031" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 tttgacccca cttttactct atcaaaattg acgggactgg aaagtcgttt ttgcgtttgt 61 tgggaaatcg aaatagcata atggggataa tcggaaccct gagcatggcc cacaaggtgt 121 acagtgcgca ctggctgcgg gagacacagg atacacagga tggcccagac gcaggctcca 181 ggactcgtgg tcgcctaccg aaatggcatc gccatcgcca ccagcagcag caagtccatg 241 tggtggtggc cagcccaaat cggcagtccc tcgaatcctc ccattccact ttcacttccc 301 attccgaatc cgaatctgag tccgattcct ccaatcccag tggcgacttc atcaggacta 361 agagatcccg aagttgccag agtttccagt ccttcaacgg atctccttcg aaggatctcc 421 gccagctggt cagctgctgg tggccattga acatctgcca cgagatgcgg cagaagctgc 481 atcagattgt ggagcactcg gcggagatct cggtggtctg gccttcggga tccggggatc 541 cagcctaagg atcgtaacca gtatagaaat aacattcggt tttaaaatta ttgtaatggt 601 catttggtaa tcaaaataaa tttttaagaa atttcagta