Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_017143196 619 bp mRNA linear INV 09-DEC-2024 mRNA. ACCESSION XM_017143196 VERSION XM_017143196.3 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Dec 9, 2024 this sequence version replaced XM_017143196.2. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..619 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..619 /gene="RpL35" /note="Ribosomal protein L35; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 9 Proteins" /db_xref="GeneID:108058460" CDS 142..513 /gene="RpL35" /codon_start=1 /product="large ribosomal subunit protein uL29" /protein_id="XP_016998685.1" /db_xref="GeneID:108058460" /translation="MVKVKCSELRTKDKKDLTKQLDELKNELLSLRVAKVTGGAPSKL SKIRVVRKAIARVYIVMHQKQKENLRKVFKNKKYKPLDLRKKKTRAIRKALSPRDANR KTLKEIRKRSVFPQRKFAVKA" misc_feature 160..330 /gene="RpL35" /note="Ribosomal L29 protein; Region: Ribosomal_L29; pfam00831" /db_xref="CDD:459954" polyA_site 619 /gene="RpL35" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 cccgccgccc tcgctggagc tggaacaggt tcgataacag cgatagctag ttcgccgcgc 61 ggagccagtg cagtgtcacc attaactagt tctcgcccca tctttctttt tctttctttt 121 ttgacgtgac cagcgagaaa aatggtgaag gttaagtgct ccgagctgag gaccaaggac 181 aagaaggacc tcaccaagca gttggatgag ctgaagaatg agctgctcag cctgcgcgtg 241 gccaaggtga ccggcggagc tccctcgaag ctctccaaga tccgcgttgt ccgcaaggcc 301 atcgcccgcg tctacatcgt gatgcaccag aagcagaagg agaacctgcg caaggtcttc 361 aagaacaaga agtacaagcc cctggatctg cgcaagaaga agacccgcgc catccgcaag 421 gccctgtcgc cccgcgacgc caaccgcaag acgctcaagg agatccgcaa gcgctccgtc 481 ttcccgcagc gcaagttcgc cgtcaaggcc taggatccac gatctgcgat ctgtctgtct 541 agtgtgcgtt aagggttcct cggttcttcg gttccatgga gaagaaaaca aataaaacct 601 tttttttaaa gtgaaaaaa