Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii Ribosomal protein L35 (RpL35),


LOCUS       XM_017143196             619 bp    mRNA    linear   INV 09-DEC-2024
            mRNA.
ACCESSION   XM_017143196
VERSION     XM_017143196.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017143196.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..619
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..619
                     /gene="RpL35"
                     /note="Ribosomal protein L35; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 9
                     Proteins"
                     /db_xref="GeneID:108058460"
     CDS             142..513
                     /gene="RpL35"
                     /codon_start=1
                     /product="large ribosomal subunit protein uL29"
                     /protein_id="XP_016998685.1"
                     /db_xref="GeneID:108058460"
                     /translation="MVKVKCSELRTKDKKDLTKQLDELKNELLSLRVAKVTGGAPSKL
                     SKIRVVRKAIARVYIVMHQKQKENLRKVFKNKKYKPLDLRKKKTRAIRKALSPRDANR
                     KTLKEIRKRSVFPQRKFAVKA"
     misc_feature    160..330
                     /gene="RpL35"
                     /note="Ribosomal L29 protein; Region: Ribosomal_L29;
                     pfam00831"
                     /db_xref="CDD:459954"
     polyA_site      619
                     /gene="RpL35"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 cccgccgccc tcgctggagc tggaacaggt tcgataacag cgatagctag ttcgccgcgc
       61 ggagccagtg cagtgtcacc attaactagt tctcgcccca tctttctttt tctttctttt
      121 ttgacgtgac cagcgagaaa aatggtgaag gttaagtgct ccgagctgag gaccaaggac
      181 aagaaggacc tcaccaagca gttggatgag ctgaagaatg agctgctcag cctgcgcgtg
      241 gccaaggtga ccggcggagc tccctcgaag ctctccaaga tccgcgttgt ccgcaaggcc
      301 atcgcccgcg tctacatcgt gatgcaccag aagcagaagg agaacctgcg caaggtcttc
      361 aagaacaaga agtacaagcc cctggatctg cgcaagaaga agacccgcgc catccgcaag
      421 gccctgtcgc cccgcgacgc caaccgcaag acgctcaagg agatccgcaa gcgctccgtc
      481 ttcccgcagc gcaagttcgc cgtcaaggcc taggatccac gatctgcgat ctgtctgtct
      541 agtgtgcgtt aagggttcct cggttcttcg gttccatgga gaagaaaaca aataaaacct
      601 tttttttaaa gtgaaaaaa