Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_017143179 1221 bp mRNA linear INV 09-DEC-2024 (LOC108058445), mRNA. ACCESSION XM_017143179 VERSION XM_017143179.3 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Dec 9, 2024 this sequence version replaced XM_017143179.2. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..1221 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..1221 /gene="LOC108058445" /note="enoyl-CoA delta isomerase 2; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 Protein" /db_xref="GeneID:108058445" CDS 77..865 /gene="LOC108058445" /codon_start=1 /product="enoyl-CoA delta isomerase 2" /protein_id="XP_016998668.2" /db_xref="GeneID:108058445" /translation="MTTDECKHFKELEVGSRSSGLFHIRFKRRWNRRTIYELMRALDL ATGDSAVQLVVLSGEFSAGCESEPLALRQGREKRMRQMPSGQQEAVTSNDPEEQYIHE KAANFVMRSLAKKLLAHRSLLVAFVQTECVGLGLSVCSLCDLVFATESAAFVPSLDHM DPCIQVGPGWLVPHLNWLLRLGDRADVGAALSCGLLVSLEGDDPQQEFWHRIEEYARL PISASLLATQRGMLRPWREALLNELRAESTPLAAQQRRLARNKL" misc_feature 122..727 /gene="LOC108058445" /note="Crotonase/Enoyl-Coenzyme A (CoA) hydratase superfamily. This superfamily contains a diverse set of enzymes including enoyl-CoA hydratase, napthoate synthase, methylmalonyl-CoA decarboxylase, 3-hydoxybutyryl-CoA dehydratase, and dienoyl-CoA isomerase; Region: crotonase-like; cl23717" /db_xref="CDD:474030" misc_feature order(161..163,260..265,281..289,464..466,470..478, 548..553) /gene="LOC108058445" /note="substrate binding site [chemical binding]; other site" /db_xref="CDD:119339" misc_feature order(281..283,476..478) /gene="LOC108058445" /note="oxyanion hole (OAH) forming residues [active]" /db_xref="CDD:119339" ORIGIN 1 ctttgaccgc ctgataagcg cagatgttta cgccggtttg tcgaccgttt gtcagtctga 61 atagtgaact cacggaatga ctacggatga gtgcaagcac ttcaaggagc tggaggtggg 121 cagcaggagc tccggcctct tccacatacg cttcaagcgg cgctggaatc gccgcaccat 181 ctacgaactg atgcgggctc tggatttggc cactggggat tccgcagtcc agttggtggt 241 tctctcgggc gaattttcag cgggatgcga gtctgaacct ctggctcttc gtcagggcag 301 agaaaagaga atgcgacaga tgccaagcgg ccagcaggag gctgtaacca gcaacgatcc 361 ggaggagcag tacatccacg agaaggcggc caactttgtg atgcgctcgc tggccaagaa 421 gctgctggcg caccgcagcc tcctggtggc ttttgtacaa accgaatgcg tgggcctggg 481 cctcagtgtg tgcagcctgt gcgatctggt ctttgccacg gagtctgctg cttttgttcc 541 ctctttggat cacatggatc cctgcatcca agtgggcccc ggctggctgg tgcctcacct 601 caactggctg ctgcgcctgg gcgatcgggc ggatgtcggt gctgctctaa gctgtgggct 661 tttagtcagc ctggagggcg atgatccgca gcaggagttc tggcatcgca ttgaagagta 721 cgcccgcctg cccatctccg cctccctgct ggccacgcag cgtggaatgc tccgcccctg 781 gcgggaggcc ctgttgaacg agctgcgcgc ggagagcacg ccgctggcgg cccagcaaag 841 acgcctggcg aggaacaagc tgtaggattg aggatcgagg gtggaaggtg tgttgattga 901 ttagcaattg taaaataaat acgggagctg aagctctaat tggagaatag ttatccatcc 961 ataaatgtat tgtccaggga tccagggaaa agtttactat gtatggtatg tataatgatt 1021 atttcctgaa ttttaaaaat atttatcagg aatttttgac acttgtaagc aaaaataatg 1081 tttattttaa atatttatta ttattttgta ttccaaaatc ataattattt taaagttata 1141 ttatgtatgg aaacaatcct atttcagaaa ctttagaaac aatcctattt tttagtttta 1201 taaatatttt taccaggaat t