Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii enoyl-CoA delta isomerase 2


LOCUS       XM_017143179            1221 bp    mRNA    linear   INV 09-DEC-2024
            (LOC108058445), mRNA.
ACCESSION   XM_017143179
VERSION     XM_017143179.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017143179.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1221
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..1221
                     /gene="LOC108058445"
                     /note="enoyl-CoA delta isomerase 2; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 1
                     Protein"
                     /db_xref="GeneID:108058445"
     CDS             77..865
                     /gene="LOC108058445"
                     /codon_start=1
                     /product="enoyl-CoA delta isomerase 2"
                     /protein_id="XP_016998668.2"
                     /db_xref="GeneID:108058445"
                     /translation="MTTDECKHFKELEVGSRSSGLFHIRFKRRWNRRTIYELMRALDL
                     ATGDSAVQLVVLSGEFSAGCESEPLALRQGREKRMRQMPSGQQEAVTSNDPEEQYIHE
                     KAANFVMRSLAKKLLAHRSLLVAFVQTECVGLGLSVCSLCDLVFATESAAFVPSLDHM
                     DPCIQVGPGWLVPHLNWLLRLGDRADVGAALSCGLLVSLEGDDPQQEFWHRIEEYARL
                     PISASLLATQRGMLRPWREALLNELRAESTPLAAQQRRLARNKL"
     misc_feature    122..727
                     /gene="LOC108058445"
                     /note="Crotonase/Enoyl-Coenzyme A (CoA) hydratase
                     superfamily. This superfamily contains a diverse set of
                     enzymes including enoyl-CoA hydratase, napthoate synthase,
                     methylmalonyl-CoA decarboxylase, 3-hydoxybutyryl-CoA
                     dehydratase, and dienoyl-CoA isomerase; Region:
                     crotonase-like; cl23717"
                     /db_xref="CDD:474030"
     misc_feature    order(161..163,260..265,281..289,464..466,470..478,
                     548..553)
                     /gene="LOC108058445"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:119339"
     misc_feature    order(281..283,476..478)
                     /gene="LOC108058445"
                     /note="oxyanion hole (OAH) forming residues [active]"
                     /db_xref="CDD:119339"
ORIGIN      
        1 ctttgaccgc ctgataagcg cagatgttta cgccggtttg tcgaccgttt gtcagtctga
       61 atagtgaact cacggaatga ctacggatga gtgcaagcac ttcaaggagc tggaggtggg
      121 cagcaggagc tccggcctct tccacatacg cttcaagcgg cgctggaatc gccgcaccat
      181 ctacgaactg atgcgggctc tggatttggc cactggggat tccgcagtcc agttggtggt
      241 tctctcgggc gaattttcag cgggatgcga gtctgaacct ctggctcttc gtcagggcag
      301 agaaaagaga atgcgacaga tgccaagcgg ccagcaggag gctgtaacca gcaacgatcc
      361 ggaggagcag tacatccacg agaaggcggc caactttgtg atgcgctcgc tggccaagaa
      421 gctgctggcg caccgcagcc tcctggtggc ttttgtacaa accgaatgcg tgggcctggg
      481 cctcagtgtg tgcagcctgt gcgatctggt ctttgccacg gagtctgctg cttttgttcc
      541 ctctttggat cacatggatc cctgcatcca agtgggcccc ggctggctgg tgcctcacct
      601 caactggctg ctgcgcctgg gcgatcgggc ggatgtcggt gctgctctaa gctgtgggct
      661 tttagtcagc ctggagggcg atgatccgca gcaggagttc tggcatcgca ttgaagagta
      721 cgcccgcctg cccatctccg cctccctgct ggccacgcag cgtggaatgc tccgcccctg
      781 gcgggaggcc ctgttgaacg agctgcgcgc ggagagcacg ccgctggcgg cccagcaaag
      841 acgcctggcg aggaacaagc tgtaggattg aggatcgagg gtggaaggtg tgttgattga
      901 ttagcaattg taaaataaat acgggagctg aagctctaat tggagaatag ttatccatcc
      961 ataaatgtat tgtccaggga tccagggaaa agtttactat gtatggtatg tataatgatt
     1021 atttcctgaa ttttaaaaat atttatcagg aatttttgac acttgtaagc aaaaataatg
     1081 tttattttaa atatttatta ttattttgta ttccaaaatc ataattattt taaagttata
     1141 ttatgtatgg aaacaatcct atttcagaaa ctttagaaac aatcctattt tttagtttta
     1201 taaatatttt taccaggaat t