Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii Cyclophilin 1 (Cyp1), mRNA.


LOCUS       XM_017143173             842 bp    mRNA    linear   INV 09-DEC-2024
ACCESSION   XM_017143173
VERSION     XM_017143173.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017143173.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..842
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..842
                     /gene="Cyp1"
                     /note="Cyclophilin 1; Derived by automated computational
                     analysis using gene prediction method: Gnomon. Supporting
                     evidence includes similarity to: 20 Proteins"
                     /db_xref="GeneID:108058438"
     CDS             16..690
                     /gene="Cyp1"
                     /codon_start=1
                     /product="peptidyl-prolyl cis-trans isomerase"
                     /protein_id="XP_016998662.2"
                     /db_xref="GeneID:108058438"
                     /translation="MVSFGATLVRQFRYKSAFHIAEAAILTKKSTTLASAACSANSQL
                     QFGIQVVREYSKASKMSTLPRVFFDMTADGEPLGRITMELRSDVVPKTAENFRALCTG
                     EKGFGYKGSIFHRVIPNFMCQGGDFTNHNGTGGKSIYGNKFPDENFQLKHTGTGILSM
                     ANAGANTNGSQFFICTVKTAWLDNKHVVFGEVVEGLDVVKKIESYGSQSGKTSKKIMV
                     ANSGSL"
     misc_feature    205..681
                     /gene="Cyp1"
                     /note="Cyclophilin A, B and H-like cyclophilin-type
                     peptidylprolyl cis- trans isomerase (PPIase) domain. This
                     family represents the archetypal cystolic cyclophilin
                     similar to human cyclophilins A, B and H. PPIase is an
                     enzyme which accelerates protein folding...; Region:
                     cyclophilin_ABH_like; cd01926"
                     /db_xref="CDD:238907"
     misc_feature    order(355..360,373..375,526..528,532..534,556..558)
                     /gene="Cyp1"
                     /note="active site"
                     /db_xref="CDD:238907"
     polyA_site      842
                     /gene="Cyp1"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 cgtcacacat acacgatggt ctctttcggt gcaactctgg ttcggcagtt tcggtacaag
       61 tcggcattcc acattgcgga ggccgccatt ttaaccaaga aatctacaac cctagcttcg
      121 gcagcgtgca gtgcgaatag tcagttgcag tttggaatcc aggttgttcg cgaatattcg
      181 aaagcgtcga agatgagtac tttgcccagg gtgtttttcg acatgaccgc cgatggcgag
      241 cccctcggta ggataacgat ggagctgcgc tccgacgttg tgcccaagac cgccgagaac
      301 ttccgcgcct tgtgcaccgg cgagaaggga ttcggctaca agggctccat tttccaccgc
      361 gtcatcccca acttcatgtg ccagggcggc gacttcacca accacaacgg cactggcggc
      421 aagtcgatct acggcaacaa gttccccgac gagaacttcc agctgaagca caccggcacc
      481 ggcatcctgt cgatggccaa cgctggcgcc aacacgaacg gctcccagtt cttcatttgc
      541 accgtgaaga ccgcctggtt ggacaacaag cacgtcgtct tcggcgaggt ggtcgagggt
      601 ctcgatgtgg tgaagaagat cgagtcctat ggctcgcagt ccggcaagac ctccaagaag
      661 atcatggttg ccaactctgg ttctctataa gaatgcgtta tagaggcaaa agcaacaaga
      721 ttacatgaag aaaaatctgt taagacggaa aaaccatttg cattttctcc aaaaacattt
      781 ttttttctac caattactgt aatattacga aaaacaaaaa tacaatacaa caatattttc
      841 aa