Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_017143173 842 bp mRNA linear INV 09-DEC-2024 ACCESSION XM_017143173 VERSION XM_017143173.3 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Dec 9, 2024 this sequence version replaced XM_017143173.2. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..842 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..842 /gene="Cyp1" /note="Cyclophilin 1; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 20 Proteins" /db_xref="GeneID:108058438" CDS 16..690 /gene="Cyp1" /codon_start=1 /product="peptidyl-prolyl cis-trans isomerase" /protein_id="XP_016998662.2" /db_xref="GeneID:108058438" /translation="MVSFGATLVRQFRYKSAFHIAEAAILTKKSTTLASAACSANSQL QFGIQVVREYSKASKMSTLPRVFFDMTADGEPLGRITMELRSDVVPKTAENFRALCTG EKGFGYKGSIFHRVIPNFMCQGGDFTNHNGTGGKSIYGNKFPDENFQLKHTGTGILSM ANAGANTNGSQFFICTVKTAWLDNKHVVFGEVVEGLDVVKKIESYGSQSGKTSKKIMV ANSGSL" misc_feature 205..681 /gene="Cyp1" /note="Cyclophilin A, B and H-like cyclophilin-type peptidylprolyl cis- trans isomerase (PPIase) domain. This family represents the archetypal cystolic cyclophilin similar to human cyclophilins A, B and H. PPIase is an enzyme which accelerates protein folding...; Region: cyclophilin_ABH_like; cd01926" /db_xref="CDD:238907" misc_feature order(355..360,373..375,526..528,532..534,556..558) /gene="Cyp1" /note="active site" /db_xref="CDD:238907" polyA_site 842 /gene="Cyp1" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 cgtcacacat acacgatggt ctctttcggt gcaactctgg ttcggcagtt tcggtacaag 61 tcggcattcc acattgcgga ggccgccatt ttaaccaaga aatctacaac cctagcttcg 121 gcagcgtgca gtgcgaatag tcagttgcag tttggaatcc aggttgttcg cgaatattcg 181 aaagcgtcga agatgagtac tttgcccagg gtgtttttcg acatgaccgc cgatggcgag 241 cccctcggta ggataacgat ggagctgcgc tccgacgttg tgcccaagac cgccgagaac 301 ttccgcgcct tgtgcaccgg cgagaaggga ttcggctaca agggctccat tttccaccgc 361 gtcatcccca acttcatgtg ccagggcggc gacttcacca accacaacgg cactggcggc 421 aagtcgatct acggcaacaa gttccccgac gagaacttcc agctgaagca caccggcacc 481 ggcatcctgt cgatggccaa cgctggcgcc aacacgaacg gctcccagtt cttcatttgc 541 accgtgaaga ccgcctggtt ggacaacaag cacgtcgtct tcggcgaggt ggtcgagggt 601 ctcgatgtgg tgaagaagat cgagtcctat ggctcgcagt ccggcaagac ctccaagaag 661 atcatggttg ccaactctgg ttctctataa gaatgcgtta tagaggcaaa agcaacaaga 721 ttacatgaag aaaaatctgt taagacggaa aaaccatttg cattttctcc aaaaacattt 781 ttttttctac caattactgt aatattacga aaaacaaaaa tacaatacaa caatattttc 841 aa