Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_017143171 824 bp mRNA linear INV 09-DEC-2024 (Rab18), mRNA. ACCESSION XM_017143171 VERSION XM_017143171.3 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Dec 9, 2024 this sequence version replaced XM_017143171.2. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..824 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..824 /gene="Rab18" /note="RAS oncogene family member Rab18; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 3 Proteins" /db_xref="GeneID:108058436" CDS 131..724 /gene="Rab18" /codon_start=1 /product="ras-related protein Rab-18" /protein_id="XP_016998660.1" /db_xref="GeneID:108058436" /translation="MADRAIKLLVIGESGVGKSSLIRRFVENKFDENHDVTIGMDFKS KVMNVDGIDYKVALWDTAGAERFRSLTPSFYRKALGAILVYDITNRDSLVKLEAWLAE LDSYSDNPNIAIIVVGNKIDQERVVDREEGRKFARKHRALFIETSAKCDQFVSDVFKD IVEKIVSSEYFNNGNSSGGVDIASNRDLEESASTCYC" misc_feature 146..625 /gene="Rab18" /note="Rab GTPase family 18 (Rab18); Region: Rab18; cd01863" /db_xref="CDD:206656" misc_feature 146..151 /gene="Rab18" /note="Rab subfamily motif 1 (RabSF1); other site" /db_xref="CDD:206656" misc_feature 164..187 /gene="Rab18" /note="G1 box; other site" /db_xref="CDD:206656" misc_feature order(170..190,218..223,239..241,317..319,485..490, 494..499,569..577) /gene="Rab18" /note="GTP/Mg2+ binding site [chemical binding]; other site" /db_xref="CDD:206656" misc_feature order(188..223,233..238) /gene="Rab18" /note="Rab subfamily motif 2 (RabSF2); other site" /db_xref="CDD:206656" misc_feature order(218..220,233..259) /gene="Rab18" /note="Switch I region; other site" /db_xref="CDD:206656" misc_feature order(233..235,245..268,287..289,293..295) /gene="Rab18" /note="putative GEF interaction site [polypeptide binding]; other site" /db_xref="CDD:206656" misc_feature 239..241 /gene="Rab18" /note="G2 box; other site" /db_xref="CDD:206656" misc_feature order(242..244,248..256,299..301,305..307,326..331, 338..340,350..352,356..367,623..625) /gene="Rab18" /note="putative effector interaction site [active]" /db_xref="CDD:206656" misc_feature order(242..247,251..253,305..310,329..331,335..337, 341..349) /gene="Rab18" /note="putative GDI interaction site [polypeptide binding]; other site" /db_xref="CDD:206656" misc_feature 242..256 /gene="Rab18" /note="Rab family motif 1 (RabF1); other site" /db_xref="CDD:206656" misc_feature 293..307 /gene="Rab18" /note="Rab family motif 2 (RabF2); other site" /db_xref="CDD:206656" misc_feature 308..319 /gene="Rab18" /note="G3 box; other site" /db_xref="CDD:206656" misc_feature order(317..319,323..355) /gene="Rab18" /note="Switch II region; other site" /db_xref="CDD:206656" misc_feature 326..343 /gene="Rab18" /note="Rab family motif 3 (RabF3); other site" /db_xref="CDD:206656" misc_feature 350..364 /gene="Rab18" /note="Rab family motif 4 (RabF4); other site" /db_xref="CDD:206656" misc_feature 377..394 /gene="Rab18" /note="Rab family motif 5 (RabF5); other site" /db_xref="CDD:206656" misc_feature 461..478 /gene="Rab18" /note="Rab subfamily motif 3 (RabSF3); other site" /db_xref="CDD:206656" misc_feature 485..496 /gene="Rab18" /note="G4 box; other site" /db_xref="CDD:206656" misc_feature 569..577 /gene="Rab18" /note="G5 box; other site" /db_xref="CDD:206656" misc_feature 617..625 /gene="Rab18" /note="Rab subfamily motif 4 (RabSF4); other site" /db_xref="CDD:206656" polyA_site 824 /gene="Rab18" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 gtgagaatgt aaacaaaccg accaggtggc aacgccgcaa ctcagttaat tcgcataaat 61 aattggcaat tcttatctat ttaagtaaat aatcgtagtg ataaacaata agtagagctc 121 acaaaaaaca atggcagatc gggctatcaa gctgctggtg atcggggaga gcggcgtggg 181 caagtccagt ttgatccgtc gcttcgtgga gaacaagttc gacgagaacc atgacgtcac 241 gatcggcatg gacttcaaga gcaaggtgat gaacgtggac ggcatcgact acaaagtggc 301 cctgtgggac acggcgggcg ccgagagatt ccgcagcctg acgcccagct tctacagaaa 361 ggccctgggc gccattctgg tgtatgacat caccaaccgc gactccctgg tcaagctgga 421 ggcctggctg gccgaactgg acagctacag cgacaacccg aacatagcca tcattgtggt 481 gggcaacaag atcgaccagg agcgagtggt ggaccgggag gagggtcgca agttcgcccg 541 caagcacaga gccctcttca tcgagacctc ggccaaatgc gatcagttcg tcagcgatgt 601 gttcaaggat attgtggaga agatcgtctc ctccgagtac ttcaacaatg gcaacagctc 661 cggcggtgtg gacatcgcca gcaatcggga tctggaggag agcgcttcca cgtgttactg 721 ttgatattcg gctgttgtgc ggcctgcttt tgtcaaattt aaaaaaccgt gtatttattt 781 aattgtttca atatcactag cataaaatca acctcaacgt tcaa