Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii RAS oncogene family member Rab18


LOCUS       XM_017143171             824 bp    mRNA    linear   INV 09-DEC-2024
            (Rab18), mRNA.
ACCESSION   XM_017143171
VERSION     XM_017143171.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017143171.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..824
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..824
                     /gene="Rab18"
                     /note="RAS oncogene family member Rab18; Derived by
                     automated computational analysis using gene prediction
                     method: Gnomon. Supporting evidence includes similarity
                     to: 3 Proteins"
                     /db_xref="GeneID:108058436"
     CDS             131..724
                     /gene="Rab18"
                     /codon_start=1
                     /product="ras-related protein Rab-18"
                     /protein_id="XP_016998660.1"
                     /db_xref="GeneID:108058436"
                     /translation="MADRAIKLLVIGESGVGKSSLIRRFVENKFDENHDVTIGMDFKS
                     KVMNVDGIDYKVALWDTAGAERFRSLTPSFYRKALGAILVYDITNRDSLVKLEAWLAE
                     LDSYSDNPNIAIIVVGNKIDQERVVDREEGRKFARKHRALFIETSAKCDQFVSDVFKD
                     IVEKIVSSEYFNNGNSSGGVDIASNRDLEESASTCYC"
     misc_feature    146..625
                     /gene="Rab18"
                     /note="Rab GTPase family 18 (Rab18); Region: Rab18;
                     cd01863"
                     /db_xref="CDD:206656"
     misc_feature    146..151
                     /gene="Rab18"
                     /note="Rab subfamily motif 1 (RabSF1); other site"
                     /db_xref="CDD:206656"
     misc_feature    164..187
                     /gene="Rab18"
                     /note="G1 box; other site"
                     /db_xref="CDD:206656"
     misc_feature    order(170..190,218..223,239..241,317..319,485..490,
                     494..499,569..577)
                     /gene="Rab18"
                     /note="GTP/Mg2+ binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:206656"
     misc_feature    order(188..223,233..238)
                     /gene="Rab18"
                     /note="Rab subfamily motif 2 (RabSF2); other site"
                     /db_xref="CDD:206656"
     misc_feature    order(218..220,233..259)
                     /gene="Rab18"
                     /note="Switch I region; other site"
                     /db_xref="CDD:206656"
     misc_feature    order(233..235,245..268,287..289,293..295)
                     /gene="Rab18"
                     /note="putative GEF interaction site [polypeptide
                     binding]; other site"
                     /db_xref="CDD:206656"
     misc_feature    239..241
                     /gene="Rab18"
                     /note="G2 box; other site"
                     /db_xref="CDD:206656"
     misc_feature    order(242..244,248..256,299..301,305..307,326..331,
                     338..340,350..352,356..367,623..625)
                     /gene="Rab18"
                     /note="putative effector interaction site [active]"
                     /db_xref="CDD:206656"
     misc_feature    order(242..247,251..253,305..310,329..331,335..337,
                     341..349)
                     /gene="Rab18"
                     /note="putative GDI interaction site [polypeptide
                     binding]; other site"
                     /db_xref="CDD:206656"
     misc_feature    242..256
                     /gene="Rab18"
                     /note="Rab family motif 1 (RabF1); other site"
                     /db_xref="CDD:206656"
     misc_feature    293..307
                     /gene="Rab18"
                     /note="Rab family motif 2 (RabF2); other site"
                     /db_xref="CDD:206656"
     misc_feature    308..319
                     /gene="Rab18"
                     /note="G3 box; other site"
                     /db_xref="CDD:206656"
     misc_feature    order(317..319,323..355)
                     /gene="Rab18"
                     /note="Switch II region; other site"
                     /db_xref="CDD:206656"
     misc_feature    326..343
                     /gene="Rab18"
                     /note="Rab family motif 3 (RabF3); other site"
                     /db_xref="CDD:206656"
     misc_feature    350..364
                     /gene="Rab18"
                     /note="Rab family motif 4 (RabF4); other site"
                     /db_xref="CDD:206656"
     misc_feature    377..394
                     /gene="Rab18"
                     /note="Rab family motif 5 (RabF5); other site"
                     /db_xref="CDD:206656"
     misc_feature    461..478
                     /gene="Rab18"
                     /note="Rab subfamily motif 3 (RabSF3); other site"
                     /db_xref="CDD:206656"
     misc_feature    485..496
                     /gene="Rab18"
                     /note="G4 box; other site"
                     /db_xref="CDD:206656"
     misc_feature    569..577
                     /gene="Rab18"
                     /note="G5 box; other site"
                     /db_xref="CDD:206656"
     misc_feature    617..625
                     /gene="Rab18"
                     /note="Rab subfamily motif 4 (RabSF4); other site"
                     /db_xref="CDD:206656"
     polyA_site      824
                     /gene="Rab18"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 gtgagaatgt aaacaaaccg accaggtggc aacgccgcaa ctcagttaat tcgcataaat
       61 aattggcaat tcttatctat ttaagtaaat aatcgtagtg ataaacaata agtagagctc
      121 acaaaaaaca atggcagatc gggctatcaa gctgctggtg atcggggaga gcggcgtggg
      181 caagtccagt ttgatccgtc gcttcgtgga gaacaagttc gacgagaacc atgacgtcac
      241 gatcggcatg gacttcaaga gcaaggtgat gaacgtggac ggcatcgact acaaagtggc
      301 cctgtgggac acggcgggcg ccgagagatt ccgcagcctg acgcccagct tctacagaaa
      361 ggccctgggc gccattctgg tgtatgacat caccaaccgc gactccctgg tcaagctgga
      421 ggcctggctg gccgaactgg acagctacag cgacaacccg aacatagcca tcattgtggt
      481 gggcaacaag atcgaccagg agcgagtggt ggaccgggag gagggtcgca agttcgcccg
      541 caagcacaga gccctcttca tcgagacctc ggccaaatgc gatcagttcg tcagcgatgt
      601 gttcaaggat attgtggaga agatcgtctc ctccgagtac ttcaacaatg gcaacagctc
      661 cggcggtgtg gacatcgcca gcaatcggga tctggaggag agcgcttcca cgtgttactg
      721 ttgatattcg gctgttgtgc ggcctgcttt tgtcaaattt aaaaaaccgt gtatttattt
      781 aattgtttca atatcactag cataaaatca acctcaacgt tcaa