Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_017143167 1007 bp mRNA linear INV 09-DEC-2024 ACCESSION XM_017143167 VERSION XM_017143167.3 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Dec 9, 2024 this sequence version replaced XM_017143167.2. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..1007 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..1007 /gene="Tsp2A" /note="tetraspanin 2A; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 2 Proteins" /db_xref="GeneID:108058434" CDS 166..900 /gene="Tsp2A" /codon_start=1 /product="tetraspanin-2A" /protein_id="XP_016998656.1" /db_xref="GeneID:108058434" /translation="MGIGYGTADEQLEKQIGCVKYTLFCFNIVAWMIATALFALTVWL RAEPGFNDWLRILEAQSFYIGVYVLIGISIVMMAVAFLGCLSALMENTMALFVFVGTQ IFGFIAIVAGSAVLMQFSTINSSLQPLLNVSLRRFVATSEYTYSSYVLTMIQENIGCC GASGPWDYLDLRQPLPSSCRDTVSGNAFFNGCVDELTWFFEGKTGWIVALAMTLGMLN VICGVMSFVLVQAVKKEEEQASNYRR" misc_feature 220..855 /gene="Tsp2A" /note="Tetraspanin family; Region: Tetraspanin; pfam00335" /db_xref="CDD:459767" polyA_site 1007 /gene="Tsp2A" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 acgactgtac ggcaccgcca actactggcc tggatgttgt caccagtatc tcggtttttg 61 gtcaaaacga tttcaacgaa cgaacccaac ggatctctct gtttccgttt cttgtctcgc 121 cactgagcaa cctatttttt tcgaccacaa caagcttccc gaaacatggg cattggctat 181 ggcaccgccg acgagcagct ggagaagcag atcggctgcg tgaagtacac gctcttctgc 241 ttcaacatcg tggcctggat gatagcgacg gccctgttcg ccctgaccgt ctggctgcgc 301 gcagagcccg gcttcaatga ctggctgcgc attctggagg cgcagtcctt ctacatcggc 361 gtctacgtgc taatcggcat cagcattgtg atgatggccg tcgccttcct aggctgcctg 421 agtgctttga tggagaacac aatggctctg ttcgttttcg tgggcaccca gatctttgga 481 ttcattgcga ttgtcgccgg ttcggcggtc ttaatgcaat tcagcaccat caactctagt 541 ttgcagccgc tgttgaatgt ctcgctgcgc cgctttgtgg ccacctcgga gtacacctac 601 tccagctatg tgctgaccat gatccaggag aatatcggct gctgcggtgc ctccgggccc 661 tgggattatc tcgatctccg gcagccgttg cccagctctt gtcgcgacac cgtcagcggc 721 aatgccttct tcaacggctg cgtggatgag ctgacctggt ttttcgaagg caaaaccggc 781 tggattgtcg cactggccat gaccctcggc atgctgaacg tcatctgtgg cgtcatgagc 841 tttgtcctgg tgcaggctgt caagaaggag gaagagcagg ccagcaacta ccgccgttga 901 agttaagtta gccctagtta ttagcgacaa gtgaccctgc gatagatcta agaattcaat 961 acccagttcg aacaataagt acaataaaga ttgcgatccc tacgaaa