Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii tetraspanin 2A (Tsp2A), mRNA.


LOCUS       XM_017143167            1007 bp    mRNA    linear   INV 09-DEC-2024
ACCESSION   XM_017143167
VERSION     XM_017143167.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017143167.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1007
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..1007
                     /gene="Tsp2A"
                     /note="tetraspanin 2A; Derived by automated computational
                     analysis using gene prediction method: Gnomon. Supporting
                     evidence includes similarity to: 2 Proteins"
                     /db_xref="GeneID:108058434"
     CDS             166..900
                     /gene="Tsp2A"
                     /codon_start=1
                     /product="tetraspanin-2A"
                     /protein_id="XP_016998656.1"
                     /db_xref="GeneID:108058434"
                     /translation="MGIGYGTADEQLEKQIGCVKYTLFCFNIVAWMIATALFALTVWL
                     RAEPGFNDWLRILEAQSFYIGVYVLIGISIVMMAVAFLGCLSALMENTMALFVFVGTQ
                     IFGFIAIVAGSAVLMQFSTINSSLQPLLNVSLRRFVATSEYTYSSYVLTMIQENIGCC
                     GASGPWDYLDLRQPLPSSCRDTVSGNAFFNGCVDELTWFFEGKTGWIVALAMTLGMLN
                     VICGVMSFVLVQAVKKEEEQASNYRR"
     misc_feature    220..855
                     /gene="Tsp2A"
                     /note="Tetraspanin family; Region: Tetraspanin; pfam00335"
                     /db_xref="CDD:459767"
     polyA_site      1007
                     /gene="Tsp2A"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 acgactgtac ggcaccgcca actactggcc tggatgttgt caccagtatc tcggtttttg
       61 gtcaaaacga tttcaacgaa cgaacccaac ggatctctct gtttccgttt cttgtctcgc
      121 cactgagcaa cctatttttt tcgaccacaa caagcttccc gaaacatggg cattggctat
      181 ggcaccgccg acgagcagct ggagaagcag atcggctgcg tgaagtacac gctcttctgc
      241 ttcaacatcg tggcctggat gatagcgacg gccctgttcg ccctgaccgt ctggctgcgc
      301 gcagagcccg gcttcaatga ctggctgcgc attctggagg cgcagtcctt ctacatcggc
      361 gtctacgtgc taatcggcat cagcattgtg atgatggccg tcgccttcct aggctgcctg
      421 agtgctttga tggagaacac aatggctctg ttcgttttcg tgggcaccca gatctttgga
      481 ttcattgcga ttgtcgccgg ttcggcggtc ttaatgcaat tcagcaccat caactctagt
      541 ttgcagccgc tgttgaatgt ctcgctgcgc cgctttgtgg ccacctcgga gtacacctac
      601 tccagctatg tgctgaccat gatccaggag aatatcggct gctgcggtgc ctccgggccc
      661 tgggattatc tcgatctccg gcagccgttg cccagctctt gtcgcgacac cgtcagcggc
      721 aatgccttct tcaacggctg cgtggatgag ctgacctggt ttttcgaagg caaaaccggc
      781 tggattgtcg cactggccat gaccctcggc atgctgaacg tcatctgtgg cgtcatgagc
      841 tttgtcctgg tgcaggctgt caagaaggag gaagagcagg ccagcaacta ccgccgttga
      901 agttaagtta gccctagtta ttagcgacaa gtgaccctgc gatagatcta agaattcaat
      961 acccagttcg aacaataagt acaataaaga ttgcgatccc tacgaaa