Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii pan gu (png), mRNA.


LOCUS       XM_017143153            1069 bp    mRNA    linear   INV 09-DEC-2024
ACCESSION   XM_017143153
VERSION     XM_017143153.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017143153.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1069
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..1069
                     /gene="png"
                     /note="pan gu; Derived by automated computational analysis
                     using gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 2 Proteins"
                     /db_xref="GeneID:108058424"
     CDS             76..951
                     /gene="png"
                     /codon_start=1
                     /product="uncharacterized protein png"
                     /protein_id="XP_016998642.2"
                     /db_xref="GeneID:108058424"
                     /translation="MDLGDSKLRAVRVLGQGTFGRVFLCLQNEGRGQKERRVCVKRII
                     VRNPKTELGLIKEEVYIISQLRHPHIVEFLRSFSHAGTVNIVMEYVPNGTLRDVIQQL
                     PKGTGGVHQERLLRFFRDMVVGLEYLHIRRVIHRDIKPENMLLDAQDRVKIADFGISN
                     VHAPSTQLQSGMGTPMYMAPEAMCSQGKVDFKSDVWSLGLVLYELCLGRSPFAALLDQ
                     NATPGQLQAVIQALVRPRLDCQLIRRLYDPVWAQVCEQMVVYEQERRICLPDVFHLDA
                     RITATLYKEYFDYSY"
     misc_feature    106..888
                     /gene="png"
                     /note="Serine/Threonine protein kinases, catalytic domain;
                     Region: S_TKc; smart00220"
                     /db_xref="CDD:214567"
     misc_feature    order(115..126,133..135,139..141,190..192,196..198,
                     286..288,334..345,484..486,496..501,505..507,535..540)
                     /gene="png"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:270870"
ORIGIN      
        1 gcttgcatcc cttggcgcgc atgcgcagct ttaactgttc aagaaggctt ctcggaacaa
       61 tctctctcct tcaatatgga tctgggcgat tccaagctgc gcgcggtgcg cgtgctgggc
      121 cagggaacct ttggccgggt gttcctctgc ctgcagaacg agggacgcgg ccagaaggag
      181 cggagggtgt gcgtcaaacg catcattgtt cgcaatccca agaccgagct gggtctgatc
      241 aaggaggagg tgtatatcat atcgcagctg cgccatccgc atatcgtcga attcctgcgc
      301 tccttcagtc acgccggcac ggtgaatata gtgatggagt atgtgcccaa tggcaccttg
      361 agggatgtca tccagcagct gcccaagggc accggtggtg tccaccagga gcgtctgctc
      421 cgcttcttcc gcgacatggt ggtgggtctc gagtatctgc acatccgacg cgtcatccat
      481 cgcgacatca agccggagaa tatgctgctc gatgcccagg atcgcgtgaa gatcgccgac
      541 tttggtatat cgaatgtgca tgcaccgagc actcagctgc agtcgggaat gggcactccc
      601 atgtacatgg ctccggaggc gatgtgtagc caaggcaagg tggacttcaa gtcggacgtc
      661 tggtcgctgg ggctggtcct ctatgagctg tgcctcggac gcagcccctt tgccgctctc
      721 ctggatcaaa atgccactcc tggccagctg caggcggtga tccaggcact ggtgcgtccc
      781 cgactcgact gccagctcat ccggcggctc tacgatcccg tgtgggcgca ggtctgcgaa
      841 cagatggtcg tctacgagca ggagcgacgc atctgcctgc cggatgtctt ccatttggac
      901 gccagaatca cagcgactct atacaaggag tactttgatt acagctatta aaacccttaa
      961 aacattgtca taattgtact tttagatcta ggaactaggc taagcaattg attacgatgt
     1021 gtgtactact gtcacttaac taaaaacatt tttctagtat aataataat