Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_017143153 1069 bp mRNA linear INV 09-DEC-2024 ACCESSION XM_017143153 VERSION XM_017143153.3 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Dec 9, 2024 this sequence version replaced XM_017143153.2. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..1069 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..1069 /gene="png" /note="pan gu; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 2 Proteins" /db_xref="GeneID:108058424" CDS 76..951 /gene="png" /codon_start=1 /product="uncharacterized protein png" /protein_id="XP_016998642.2" /db_xref="GeneID:108058424" /translation="MDLGDSKLRAVRVLGQGTFGRVFLCLQNEGRGQKERRVCVKRII VRNPKTELGLIKEEVYIISQLRHPHIVEFLRSFSHAGTVNIVMEYVPNGTLRDVIQQL PKGTGGVHQERLLRFFRDMVVGLEYLHIRRVIHRDIKPENMLLDAQDRVKIADFGISN VHAPSTQLQSGMGTPMYMAPEAMCSQGKVDFKSDVWSLGLVLYELCLGRSPFAALLDQ NATPGQLQAVIQALVRPRLDCQLIRRLYDPVWAQVCEQMVVYEQERRICLPDVFHLDA RITATLYKEYFDYSY" misc_feature 106..888 /gene="png" /note="Serine/Threonine protein kinases, catalytic domain; Region: S_TKc; smart00220" /db_xref="CDD:214567" misc_feature order(115..126,133..135,139..141,190..192,196..198, 286..288,334..345,484..486,496..501,505..507,535..540) /gene="png" /note="ATP binding site [chemical binding]; other site" /db_xref="CDD:270870" ORIGIN 1 gcttgcatcc cttggcgcgc atgcgcagct ttaactgttc aagaaggctt ctcggaacaa 61 tctctctcct tcaatatgga tctgggcgat tccaagctgc gcgcggtgcg cgtgctgggc 121 cagggaacct ttggccgggt gttcctctgc ctgcagaacg agggacgcgg ccagaaggag 181 cggagggtgt gcgtcaaacg catcattgtt cgcaatccca agaccgagct gggtctgatc 241 aaggaggagg tgtatatcat atcgcagctg cgccatccgc atatcgtcga attcctgcgc 301 tccttcagtc acgccggcac ggtgaatata gtgatggagt atgtgcccaa tggcaccttg 361 agggatgtca tccagcagct gcccaagggc accggtggtg tccaccagga gcgtctgctc 421 cgcttcttcc gcgacatggt ggtgggtctc gagtatctgc acatccgacg cgtcatccat 481 cgcgacatca agccggagaa tatgctgctc gatgcccagg atcgcgtgaa gatcgccgac 541 tttggtatat cgaatgtgca tgcaccgagc actcagctgc agtcgggaat gggcactccc 601 atgtacatgg ctccggaggc gatgtgtagc caaggcaagg tggacttcaa gtcggacgtc 661 tggtcgctgg ggctggtcct ctatgagctg tgcctcggac gcagcccctt tgccgctctc 721 ctggatcaaa atgccactcc tggccagctg caggcggtga tccaggcact ggtgcgtccc 781 cgactcgact gccagctcat ccggcggctc tacgatcccg tgtgggcgca ggtctgcgaa 841 cagatggtcg tctacgagca ggagcgacgc atctgcctgc cggatgtctt ccatttggac 901 gccagaatca cagcgactct atacaaggag tactttgatt acagctatta aaacccttaa 961 aacattgtca taattgtact tttagatcta ggaactaggc taagcaattg attacgatgt 1021 gtgtactact gtcacttaac taaaaacatt tttctagtat aataataat