Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii Ubiquinol-cytochrome c reductase


LOCUS       XM_017143120             533 bp    mRNA    linear   INV 09-DEC-2024
            14 kDa subunit (UQCR-14), mRNA.
ACCESSION   XM_017143120
VERSION     XM_017143120.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017143120.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..533
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..533
                     /gene="UQCR-14"
                     /note="Ubiquinol-cytochrome c reductase 14 kDa subunit;
                     Derived by automated computational analysis using gene
                     prediction method: Gnomon. Supporting evidence includes
                     similarity to: 3 Proteins"
                     /db_xref="GeneID:108058415"
     CDS             119..454
                     /gene="UQCR-14"
                     /codon_start=1
                     /product="cytochrome b-c1 complex subunit 7"
                     /protein_id="XP_016998609.1"
                     /db_xref="GeneID:108058415"
                     /translation="MSNYIARKGPAVLSNLGRWAYNLSGFNQYGLHRDDCLYENEDVK
                     EAVRRLPRKLYDERNYRIMRALHLSMTKTILPKEQWTKYEEDVKYLEPYLKEVTKERE
                     EREDWEKIH"
     misc_feature    152..433
                     /gene="UQCR-14"
                     /note="Ubiquinol-cytochrome C reductase complex 14kD
                     subunit; Region: UCR_14kD; pfam02271"
                     /db_xref="CDD:460519"
     polyA_site      533
                     /gene="UQCR-14"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 tgggaatcga tagggaagtg cgatacgttc gaggtccatc tctagcaata taaccatacc
       61 taaaataaaa agcggaggaa ttctctttcc tttcccgact tctaatttta cgtaaaccat
      121 gtcgaactat attgccagga agggacccgc cgttctctct aatctgggca gatgggccta
      181 caacctctcc ggattcaacc aatacggatt gcatcgggat gactgtctgt acgagaacga
      241 ggacgttaag gaggccgtcc gccgattgcc aaggaagctc tacgacgagc gcaactaccg
      301 catcatgagg gccctccacc tgtccatgac caagacgatc ctgcccaagg agcagtggac
      361 caagtacgag gaggacgtca agtatctgga gccctatctc aaggaggtca ccaaggagcg
      421 cgaggagcgt gaggactggg agaagatcca ctaaacacgc tacatacgcc actaaatccg
      481 acttcttctg gacttgtaaa tgttgaaata catagcttag ataaacacca aaa