Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_017143120 533 bp mRNA linear INV 09-DEC-2024 14 kDa subunit (UQCR-14), mRNA. ACCESSION XM_017143120 VERSION XM_017143120.3 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Dec 9, 2024 this sequence version replaced XM_017143120.2. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..533 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..533 /gene="UQCR-14" /note="Ubiquinol-cytochrome c reductase 14 kDa subunit; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 3 Proteins" /db_xref="GeneID:108058415" CDS 119..454 /gene="UQCR-14" /codon_start=1 /product="cytochrome b-c1 complex subunit 7" /protein_id="XP_016998609.1" /db_xref="GeneID:108058415" /translation="MSNYIARKGPAVLSNLGRWAYNLSGFNQYGLHRDDCLYENEDVK EAVRRLPRKLYDERNYRIMRALHLSMTKTILPKEQWTKYEEDVKYLEPYLKEVTKERE EREDWEKIH" misc_feature 152..433 /gene="UQCR-14" /note="Ubiquinol-cytochrome C reductase complex 14kD subunit; Region: UCR_14kD; pfam02271" /db_xref="CDD:460519" polyA_site 533 /gene="UQCR-14" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 tgggaatcga tagggaagtg cgatacgttc gaggtccatc tctagcaata taaccatacc 61 taaaataaaa agcggaggaa ttctctttcc tttcccgact tctaatttta cgtaaaccat 121 gtcgaactat attgccagga agggacccgc cgttctctct aatctgggca gatgggccta 181 caacctctcc ggattcaacc aatacggatt gcatcgggat gactgtctgt acgagaacga 241 ggacgttaag gaggccgtcc gccgattgcc aaggaagctc tacgacgagc gcaactaccg 301 catcatgagg gccctccacc tgtccatgac caagacgatc ctgcccaagg agcagtggac 361 caagtacgag gaggacgtca agtatctgga gccctatctc aaggaggtca ccaaggagcg 421 cgaggagcgt gaggactggg agaagatcca ctaaacacgc tacatacgcc actaaatccg 481 acttcttctg gacttgtaaa tgttgaaata catagcttag ataaacacca aaa