Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_017143119 701 bp mRNA linear INV 09-DEC-2024 (LOC108058414), mRNA. ACCESSION XM_017143119 VERSION XM_017143119.3 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Dec 9, 2024 this sequence version replaced XM_017143119.2. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..701 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..701 /gene="LOC108058414" /note="vesicle transport protein GOT1B; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 2 Proteins" /db_xref="GeneID:108058414" CDS 136..558 /gene="LOC108058414" /codon_start=1 /product="vesicle transport protein GOT1B" /protein_id="XP_016998608.1" /db_xref="GeneID:108058414" /translation="MIEITDLQKIGIGLAGFGISFLFLGMLLLFDKGLLAIGNILFIS GLGCVIGVERTLRFFFQRHKVKGTTAFFGGIVIVLLGFPIIGMIIESYGFFALFSGFF PVAINFLGRVPVLGSLLNLPFMQKIVQRLGGDGNRTTV" misc_feature 145..495 /gene="LOC108058414" /note="Got1/Sft2-like family; Region: Got1; cl02130" /db_xref="CDD:470475" polyA_site 701 /gene="LOC108058414" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 ttgtttacat tcgctagcac taaaactttg aatgaaagtg gaaatcagct gttttgtgct 61 ttgaaattga attgctgttt acgtggattt tttttattcg attcaacatc aatttaaagc 121 ggcagcgcat ccaaaatgat tgagataaca gatctgcaga aaattggcat cggcttggct 181 ggctttggca tctcgtttct gtttctcggc atgctgctgc tgttcgacaa aggcctgctc 241 gccatcggca acattctatt catatcgggc ctcggctgtg tgatcggcgt ggagcgcacc 301 ctgcgcttct tcttccagcg gcacaaagtc aaaggcacca ccgccttttt cgggggcatt 361 gtcatcgtcc tgctgggatt ccccatcatt ggcatgatta ttgaatccta tggattcttc 421 gcactgttca gcggcttctt ccccgtggcc attaatttcc tgggacgagt gccagtcctg 481 ggatcgctgt taaatttacc atttatgcaa aagattgttc aaagactcgg aggagacggc 541 aaccgaacta cagtataaat atatctgtac agtttaccac aattgtgcaa agactttgta 601 taaagtaaat aaaatcaatt taaattcttg tatacccatt aaactccatg taaaaatctg 661 ccttcataaa caaaatactt gtagtttatc aaaccgaata a