Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii vesicle transport protein GOT1B


LOCUS       XM_017143119             701 bp    mRNA    linear   INV 09-DEC-2024
            (LOC108058414), mRNA.
ACCESSION   XM_017143119
VERSION     XM_017143119.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017143119.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..701
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..701
                     /gene="LOC108058414"
                     /note="vesicle transport protein GOT1B; Derived by
                     automated computational analysis using gene prediction
                     method: Gnomon. Supporting evidence includes similarity
                     to: 2 Proteins"
                     /db_xref="GeneID:108058414"
     CDS             136..558
                     /gene="LOC108058414"
                     /codon_start=1
                     /product="vesicle transport protein GOT1B"
                     /protein_id="XP_016998608.1"
                     /db_xref="GeneID:108058414"
                     /translation="MIEITDLQKIGIGLAGFGISFLFLGMLLLFDKGLLAIGNILFIS
                     GLGCVIGVERTLRFFFQRHKVKGTTAFFGGIVIVLLGFPIIGMIIESYGFFALFSGFF
                     PVAINFLGRVPVLGSLLNLPFMQKIVQRLGGDGNRTTV"
     misc_feature    145..495
                     /gene="LOC108058414"
                     /note="Got1/Sft2-like family; Region: Got1; cl02130"
                     /db_xref="CDD:470475"
     polyA_site      701
                     /gene="LOC108058414"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 ttgtttacat tcgctagcac taaaactttg aatgaaagtg gaaatcagct gttttgtgct
       61 ttgaaattga attgctgttt acgtggattt tttttattcg attcaacatc aatttaaagc
      121 ggcagcgcat ccaaaatgat tgagataaca gatctgcaga aaattggcat cggcttggct
      181 ggctttggca tctcgtttct gtttctcggc atgctgctgc tgttcgacaa aggcctgctc
      241 gccatcggca acattctatt catatcgggc ctcggctgtg tgatcggcgt ggagcgcacc
      301 ctgcgcttct tcttccagcg gcacaaagtc aaaggcacca ccgccttttt cgggggcatt
      361 gtcatcgtcc tgctgggatt ccccatcatt ggcatgatta ttgaatccta tggattcttc
      421 gcactgttca gcggcttctt ccccgtggcc attaatttcc tgggacgagt gccagtcctg
      481 ggatcgctgt taaatttacc atttatgcaa aagattgttc aaagactcgg aggagacggc
      541 aaccgaacta cagtataaat atatctgtac agtttaccac aattgtgcaa agactttgta
      601 taaagtaaat aaaatcaatt taaattcttg tatacccatt aaactccatg taaaaatctg
      661 ccttcataaa caaaatactt gtagtttatc aaaccgaata a