PREDICTED: Drosophila takahashii thioredoxin (LOC108058409), mRNA.

LOCUS       XM_017143111             824 bp    mRNA    linear   INV 09-DEC-2024
ACCESSION   XM_017143111
VERSION     XM_017143111.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017143111.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..824
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..824
                     /gene="LOC108058409"
                     /note="thioredoxin; Derived by automated computational
                     analysis using gene prediction method: Gnomon. Supporting
                     evidence includes similarity to: 2 Proteins"
                     /db_xref="GeneID:108058409"
     CDS             168..656
                     /gene="LOC108058409"
                     /codon_start=1
                     /product="thioredoxin"
                     /protein_id="XP_016998600.1"
                     /db_xref="GeneID:108058409"
                     /translation="MLKIAAEGLAPRLVACCSIGATSAHSGCHRVAPQAAKATQKYLS
                     QSQHLHKKLVIKDHYEFDQKVINSDNPVIVNFHAEWCDPCKILTPKMLELLENSNEID
                     VAIIDVETNLDLVETFEVKAVPAVLAFRNGVVVDKFIGLVDANSIETLIDKLKRKQQQ
                     KQ"
     misc_feature    345..623
                     /gene="LOC108058409"
                     /note="Chaperedoxin CnoX, contains thioredoxin-like and
                     TPR-like domains, YbbN/TrxSC family [Posttranslational
                     modification, protein turnover, chaperones]; Region: CnoX;
                     COG3118"
                     /db_xref="CDD:442352"
     polyA_site      824
                     /gene="LOC108058409"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 tccgcagttt ataaacaaac attaaacgca cacacgcagt aatacacacg gaaaaactag
       61 ttaaacaccc cgtagaagca gcagcagcag cgcaatctaa tcgttgcgaa tcgccgtgtt
      121 ccgtgctccg cacccacatc cacctccgca ctcgcacccc ccgcaaaatg ctgaagatcg
      181 ccgccgaggg gctggcgcca cgtctggtgg cctgttgctc catcggagcc accagtgccc
      241 acagtggctg ccacagggtg gcgccccagg cggccaaggc cacccagaag tacctgtcgc
      301 agtcgcagca cctccacaag aagctggtca tcaaggatca ctacgagttc gatcagaagg
      361 tgatcaacag cgacaacccg gtgatcgtga acttccacgc cgaatggtgc gatccctgca
      421 agatactcac gccgaagatg ctcgagctgc tggagaactc caacgagatc gatgtggcga
      481 tcatcgatgt ggagacgaac ctggatctcg tcgagacgtt cgaggtgaag gcggtgccgg
      541 cggtgctggc cttccggaac ggcgtcgtgg tggacaagtt catcggtttg gtggatgcca
      601 acagcatcga gacgctgatc gacaagctga agcggaagca gcagcagaag cagtagttgg
      661 agtagcataa ttggaactgg gaggtcatga ttttaaaacg gaaacgatac gggagactgc
      721 gaggcaaaaa caatgcaatg caatcattga tgctgaaaga gagtgtgcac aaaatacttt
      781 aatatgcaat aaaactaatc ttaactatgg ctatttttaa ctca