Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_017143108 554 bp mRNA linear INV 09-DEC-2024 mitochondrial (LOC108058406), mRNA. ACCESSION XM_017143108 VERSION XM_017143108.3 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Dec 9, 2024 this sequence version replaced XM_017143108.2. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..554 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..554 /gene="LOC108058406" /note="HIG1 domain family member 2A, mitochondrial; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 3 Proteins" /db_xref="GeneID:108058406" CDS 93..401 /gene="LOC108058406" /codon_start=1 /product="HIG1 domain family member 2A, mitochondrial" /protein_id="XP_016998597.1" /db_xref="GeneID:108058406" /translation="MSNKIQVALPEEELDWIQLRQDLGPVAEVETTKEKLQRKIKENP LVPLGCLATTAALTAGLYNFRTGNRKMSQLMMRTRIAAQGFTVLALVAGVVMTYTDKK " misc_feature 216..371 /gene="LOC108058406" /note="Hypoxia induced protein conserved region; Region: HIG_1_N; pfam04588" /db_xref="CDD:461361" polyA_site 554 /gene="LOC108058406" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 tcacggggtc catctctaat tcaataatag aattcgactt gtttgtagtt tgcgctactg 61 ttttgccaat atttacttgg aatatcagcg aaatgtcgaa caaaattcag gtggcgctgc 121 cggaggagga actggactgg atccaactgc gccaggacct gggacccgtg gccgaggtgg 181 agacgacgaa ggagaagctg cagcgcaaga taaaggagaa tccgctggtt ccgctgggat 241 gtttggccac cacagcggca ctcacagccg gattatacaa ctttcgcact ggcaatcgca 301 agatgtccca gctgatgatg cgcactcgaa tcgccgctca gggattcacc gttttggccc 361 tggttgccgg cgtcgtcatg acttacactg ataaaaaata actatgtgat cataaatata 421 taggctgaat tttgaattcg gttttgtttt tttttttagc acgttgttac aaaagctacc 481 acctacggct ataaatgtta aatatatatg ttttctttta tatagaaagt aactaaaaaa 541 tatgtacctc caaa