Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii HIG1 domain family member 2A,


LOCUS       XM_017143108             554 bp    mRNA    linear   INV 09-DEC-2024
            mitochondrial (LOC108058406), mRNA.
ACCESSION   XM_017143108
VERSION     XM_017143108.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017143108.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..554
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..554
                     /gene="LOC108058406"
                     /note="HIG1 domain family member 2A, mitochondrial;
                     Derived by automated computational analysis using gene
                     prediction method: Gnomon. Supporting evidence includes
                     similarity to: 3 Proteins"
                     /db_xref="GeneID:108058406"
     CDS             93..401
                     /gene="LOC108058406"
                     /codon_start=1
                     /product="HIG1 domain family member 2A, mitochondrial"
                     /protein_id="XP_016998597.1"
                     /db_xref="GeneID:108058406"
                     /translation="MSNKIQVALPEEELDWIQLRQDLGPVAEVETTKEKLQRKIKENP
                     LVPLGCLATTAALTAGLYNFRTGNRKMSQLMMRTRIAAQGFTVLALVAGVVMTYTDKK
                     "
     misc_feature    216..371
                     /gene="LOC108058406"
                     /note="Hypoxia induced protein conserved region; Region:
                     HIG_1_N; pfam04588"
                     /db_xref="CDD:461361"
     polyA_site      554
                     /gene="LOC108058406"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 tcacggggtc catctctaat tcaataatag aattcgactt gtttgtagtt tgcgctactg
       61 ttttgccaat atttacttgg aatatcagcg aaatgtcgaa caaaattcag gtggcgctgc
      121 cggaggagga actggactgg atccaactgc gccaggacct gggacccgtg gccgaggtgg
      181 agacgacgaa ggagaagctg cagcgcaaga taaaggagaa tccgctggtt ccgctgggat
      241 gtttggccac cacagcggca ctcacagccg gattatacaa ctttcgcact ggcaatcgca
      301 agatgtccca gctgatgatg cgcactcgaa tcgccgctca gggattcacc gttttggccc
      361 tggttgccgg cgtcgtcatg acttacactg ataaaaaata actatgtgat cataaatata
      421 taggctgaat tttgaattcg gttttgtttt tttttttagc acgttgttac aaaagctacc
      481 acctacggct ataaatgtta aatatatatg ttttctttta tatagaaagt aactaaaaaa
      541 tatgtacctc caaa