Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_017143083 803 bp mRNA linear INV 09-DEC-2024 (LOC108058390), mRNA. ACCESSION XM_017143083 VERSION XM_017143083.3 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Dec 9, 2024 this sequence version replaced XM_017143083.2. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..803 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..803 /gene="LOC108058390" /note="histidine-rich glycoprotein; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 Protein" /db_xref="GeneID:108058390" CDS 164..616 /gene="LOC108058390" /codon_start=1 /product="histidine-rich glycoprotein" /protein_id="XP_016998572.1" /db_xref="GeneID:108058390" /translation="MLKFILPCLALLAVSGALKIHDYHQGHEEYEHHHEHHEPEHQAH YEPEHEETELHHEVDHKHATSHQSVKFHHYHAVPVYIKKEDQHLVKKPIEIGGTKQKL KILHPKSEHNHNHGLVLENHSESHVHEHGHYEEPVHHSEHYEHYSHHE" ORIGIN 1 tgccacaggt tggccgggta taaatcgaat ctggaatcga agatagagcc acattcagcc 61 ttccactgcc aaggagagca cttcgcgtaa cttcggtcct cggtttcgaa tattttttta 121 agtgattcag tgtgttgtgt tcaactaaaa tatccagaaa atcatgctga aatttattct 181 tccctgcctg gcacttctgg ccgtgagcgg agccctgaag atccacgact accaccaggg 241 ccacgaggag tacgagcacc accacgaaca ccacgagccg gagcaccagg cccactacga 301 gccggagcac gaggagacgg agctgcacca cgaggtggac cacaagcacg ccacgtcgca 361 ccagagcgtc aagttccatc actaccatgc cgtgcccgtc tacatcaaga aggaggacca 421 gcacctcgtg aagaagccca tcgagatcgg cggcacaaag cagaagctga agatcctgca 481 cccgaagagc gagcacaacc acaaccacgg cctggtgctg gagaaccaca gcgagtcgca 541 cgtccacgag cacggccact acgaggagcc ggtgcatcat tcggagcact acgaacacta 601 ctcgcaccac gagtaggatc tgaatcggga ttcctgtcaa ggattctgga cccgaatcgg 661 gaatgccaaa tgagctgtag ggttttcgtt tagcgtctaa ggtctttcta cgttaatttt 721 tttgtgttaa taaagcgttc gcctagagta tagagtatac catccaaatc aagcgctgtt 781 ttattatttt aacatttgtg aat